| IED ID | IndEnz0002016501 |
| Enzyme Type ID | protease016501 |
| Protein Name |
Conglutin-7 2S protein 1 Seed storage protein SSP1 Seed storage protein SSP2 allergen Ara h 2 |
| Gene Name | |
| Organism | Arachis hypogaea (Peanut) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Papilionoideae 50 kb inversion clade dalbergioids sensu lato Dalbergieae Pterocarpus clade Arachis Arachis hypogaea (Peanut) |
| Enzyme Sequence | MAKLTILVALALFLLAAHASARQQWELQGDRRCQSQLERANLRPCEQHLMQKIQRDEDSYGRDPYSPSQDPYSPSQDPDRRDPYSPSPYDRRGAGSSQHQERCCNELNEFENNQRCMCEALQQIMENQSDRLQGRQQEQQFKRELRNLPQQCGLRAPQRCDLEVESGGRDRY |
| Enzyme Length | 172 |
| Uniprot Accession Number | Q6PSU2 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Weak inhibitor of trypsin. {ECO:0000269|PubMed:12847498}. |
| Temperature Dependency | BIOPHYSICOCHEMICAL PROPERTIES: Temperature dependence: Thermostable. {ECO:0000269|PubMed:16372900}; |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Alternative sequence (2); Chain (1); Disulfide bond (4); Erroneous initiation (3); Modified residue (3); Region (1); Sequence conflict (12); Signal peptide (1) |
| Keywords | Allergen;Alternative splicing;Direct protein sequencing;Disulfide bond;Hydroxylation;IgE-binding protein;Protease inhibitor;Seed storage protein;Serine protease inhibitor;Signal;Storage protein |
| Interact With | |
| Induction | INDUCTION: Repressed by water stress. {ECO:0000269|Ref.12}. |
| Subcellular Location | |
| Modified Residue | MOD_RES 67; /note=4-hydroxyproline; /evidence=ECO:0000269|PubMed:19937656; MOD_RES 74; /note=4-hydroxyproline; /evidence=ECO:0000269|PubMed:19937656; MOD_RES 86; /note=4-hydroxyproline; /evidence=ECO:0000269|PubMed:19937656 |
| Post Translational Modification | PTM: The hydroxyproline modifications determined by mass spectrometry are probably 4-hydroxyproline as determined for other extracellular plant proteins. {ECO:0000269|PubMed:19937656}. |
| Signal Peptide | SIGNAL 1..21; /evidence="ECO:0000269|PubMed:12759484, ECO:0000269|Ref.12" |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 20,114 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |