| IED ID | IndEnz0002016504 |
| Enzyme Type ID | protease016504 |
| Protein Name |
25 kDa core protein A12L Cleaved into: 17 kDa core protein A12L 17K |
| Gene Name | A12L |
| Organism | Vaccinia virus (strain Copenhagen) (VACV) |
| Taxonomic Lineage | Viruses Varidnaviria Bamfordvirae Nucleocytoviricota Pokkesviricetes Chitovirales Poxviridae Chordopoxvirinae Orthopoxvirus Vaccinia virus Vaccinia virus (strain Copenhagen) (VACV) |
| Enzyme Sequence | MADKKNLAVRSSYDDYIETVNKITPQLKNLLAQIGGDAAVKGGNNNLNSQTDVTAGACDTKSKSSKCITCKPKSKSSSSSTSTSKGSKNTSGAPRRRTTVTTTSYNAMDGQIVQAVTNAGKIVYGTVRDGQLEVRGMVGEINHDLLGIDSVNAGKKKPSKKMPTNKKINMSSGMRRQEQINPDDCCLDMGMY |
| Enzyme Length | 192 |
| Uniprot Accession Number | P20989 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Component of the virion core that undergoes proteolytic processing during the immature virion (IV) to mature virion (MV) transition. Essential for the formation of a structurally normal core (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (2); Compositional bias (1); Region (2); Site (1) |
| Keywords | Late protein;Reference proteome;Virion |
| Interact With | |
| Induction | INDUCTION: Expressed in the late phase of the viral replicative cycle. |
| Subcellular Location | SUBCELLULAR LOCATION: [25 kDa core protein A12L]: Virion {ECO:0000250}. Note=Localizes to the virion core. {ECO:0000250}.; SUBCELLULAR LOCATION: [17 kDa core protein A12L]: Virion {ECO:0000250}. Note=Localizes to the virion core. {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | PTM: The 25-kDa precursor is cleaved to a mature protein of 17 kDa during virion maturation. Further proteolytic processing is supposed to occur since five more A12L-derived products have been observed (By similarity). {ECO:0000250}. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 10781095; |
| Motif | |
| Gene Encoded By | |
| Mass | 20,519 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |