| IED ID | IndEnz0002016525 |
| Enzyme Type ID | protease016525 |
| Protein Name |
Cystatin-related protein 1 CRP-1 Androgen-regulated 20 kDa protein Prostatic 22 kDa glycoprotein P22K16/P22K20 |
| Gene Name | Andpro Crp1 |
| Organism | Rattus norvegicus (Rat) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Rattus Rattus norvegicus (Rat) |
| Enzyme Sequence | MCKTLHGTLLLLAIFVLFLNFSHATAKRTRRGMEIFEKNFIDKNKLKDVYDVFKYLYNTHSADTYLSNIKNESFTMNIWGFGEIEMVKTKCRKIDSDFYKCSFQREFYNLKRTPGETMYYISLPGSVRCRKLLSKLDNCPFEEQTEQLKREICYFVVYPDYIEQNIHAVRFDCYTK |
| Enzyme Length | 176 |
| Uniprot Accession Number | P22282 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (2); Glycosylation (1); Propeptide (1); Sequence conflict (5); Signal peptide (1) |
| Keywords | Cleavage on pair of basic residues;Direct protein sequencing;Disulfide bond;Glycoprotein;Protease inhibitor;Reference proteome;Signal;Thiol protease inhibitor |
| Interact With | |
| Induction | INDUCTION: By androgens. |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..26; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 19578134; 20007950; 8892321; |
| Motif | |
| Gene Encoded By | |
| Mass | 21,060 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |