| IED ID | IndEnz0002016549 |
| Enzyme Type ID | protease016549 |
| Protein Name |
DELTA-sagatoxin-Srs1a DELTA-SATX-Srs1a Cytolysin Src-1 Src I |
| Gene Name | |
| Organism | Sagartia rosea (Sea anemone) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Cnidaria Anthozoa (anthozoans) Hexacorallia Actiniaria (sea anemones) Sagartiidae Sagartia Sagartia rosea (Sea anemone) |
| Enzyme Sequence | MSRLIVVCIVISMICGALSLSSTKMADEKKEKDEDEKPKISGGTVIAAGRLTLDLLKTLLGTLGSISRKIAIGVDNETGGLITGNNVYFRSGTSDDILPHRVETGEALLYTARKTKGPVATGAVGVFTYYLSDGNTLAVLFSVPFDYNFYSNWWNVKIYSGKRNADYDMYHELYYDANPFEGDDTWEYRYLGYGMRMEGYMNSPGEAILKITVMPD |
| Enzyme Length | 216 |
| Uniprot Accession Number | Q86FQ0 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | BINDING 91; /note=Phosphocholine; /evidence=ECO:0000250|UniProtKB:P07845; BINDING 124; /note=Phosphocholine; /evidence=ECO:0000250|UniProtKB:P07845; BINDING 142; /note=Phosphocholine; /evidence=ECO:0000250|UniProtKB:P07845; BINDING 144; /note=Phosphocholine; /evidence=ECO:0000250|UniProtKB:P07845; BINDING 170; /note=Phosphocholine; /evidence=ECO:0000250|UniProtKB:P07845; BINDING 174; /note=Phosphocholine; /evidence=ECO:0000250|UniProtKB:P07845; BINDING 175; /note=Phosphocholine; /evidence=ECO:0000250|UniProtKB:P07845 |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Pore-forming protein that forms cations-selective hydrophilic pores of around 1 nm and causes cytolysis and hemolysis. Pore formation is a multi-step process that involves specific recognition of membrane sphingomyelin (but neither cholesterol nor phosphatidylcholine) using aromatic rich region and adjacent phosphocholine (POC) binding site, firm binding to the membrane (mainly driven by hydrophobic interactions) accompanied by the transfer of the N-terminal region to the lipid-water interface and finally pore formation after oligomerization of monomers. {ECO:0000269|PubMed:14680802}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Binding site (7); Chain (1); Propeptide (1); Region (3); Signal peptide (1); Site (1) |
| Keywords | Cytolysis;Direct protein sequencing;Hemolysis;Ion transport;Membrane;Nematocyst;Secreted;Signal;Target cell membrane;Target membrane;Toxin;Transmembrane;Transport |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. Nematocyst. Target cell membrane. Note=Forms an alpha-helical membrane channel in the prey. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..19; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 23,944 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |