| IED ID | IndEnz0002016554 |
| Enzyme Type ID | protease016554 |
| Protein Name |
Caspase-1 EC 3.4.22.- Cleaved into: Caspase-1 subunit p19/18; Caspase-1 subunit p12 |
| Gene Name | |
| Organism | Spodoptera frugiperda (Fall armyworm) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Mandibulata Pancrustacea Hexapoda Insecta Dicondylia Pterygota (winged insects) Neoptera Endopterygota Amphiesmenoptera Lepidoptera (butterflies and moths) Glossata Neolepidoptera Heteroneura Ditrysia Obtectomera Noctuoidea Noctuidae (owlet moths) Amphipyrinae Spodoptera Spodoptera frugiperda (Fall armyworm) |
| Enzyme Sequence | MLDGKQDNGNVDSVDIKQRTNGGGDEGDALGSNSSSQPNRVARMPVDRNAPYYNMNHKHRGMAIIFNHEHFDIHSLKSRTGTNVDSDNLSKVLKTLGFKVTVFPNLKSEEINKFIQQTAEMDHSDADCLLVAVLTHGELGMLYAKDTHYKPDNLWYYFTADKCPTLAGKPKLFFIQACQGDRLDGGITLSRTETDGSPSTSYRIPVHADFLIAFSTVPGYFSWRNTTRGSWFMQALCEELRYAGTERDILTLLTFVCQKVALDFESNAPDSAMMHQQKQVPCITSMLTRLLVFGKKQSH |
| Enzyme Length | 299 |
| Uniprot Accession Number | P89116 |
| Absorption | |
| Active Site | ACT_SITE 136; /evidence=ECO:0000250; ACT_SITE 178; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.22.- |
| Enzyme Function | FUNCTION: Involved in the activation cascade of caspases responsible for apoptosis execution (By similarity). Inhibited by the baculovirus anti-apoptotic protein p35. Cleaves p35 and nuclear immunophilin FKBP46. {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Beta strand (15); Chain (2); Compositional bias (1); Helix (8); Propeptide (2); Region (1); Turn (3) |
| Keywords | 3D-structure;Apoptosis;Direct protein sequencing;Hydrolase;Protease;Thiol protease;Zymogen |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | PTM: The two subunits are derived from the precursor sequence by an autocatalytic mechanism. |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (2) |
| Cross Reference PDB | 1M72; 2NN3; |
| Mapped Pubmed ID | 14645217; |
| Motif | |
| Gene Encoded By | |
| Mass | 33,527 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda | 3.4.22.36; |