| IED ID | IndEnz0002016576 |
| Enzyme Type ID | protease016576 |
| Protein Name |
Accessory gene regulator protein B EC 3.4.-.- |
| Gene Name | agrB USA300HOU_2032 |
| Organism | Staphylococcus aureus (strain USA300 / TCH1516) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus aureus Staphylococcus aureus (strain USA300) Staphylococcus aureus (strain USA300 / TCH1516) |
| Enzyme Sequence | MNYFDNKIDQFATYLQKRNNLDHIQFLQVRLGMQVLAKNIGKLIVMYTIAYILNIFLFTLITNLTFYLIRRHAHGAHAPSSFWCYVESIILFILLPLVIVNFHINFLIMIILTVISLGVISVYAPAATKKKPIPVRLIKRKKYYAIIVSLTLFIITLIIKEPFAQFIQLGIIIEAITLLPIFFIKEDLK |
| Enzyme Length | 189 |
| Uniprot Accession Number | A8Z4U0 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.-.- |
| Enzyme Function | FUNCTION: Essential for the production of a quorum sensing system signal molecule, the autoinducing peptide (AIP). This quorum sensing system is responsible for the regulation of the expression of virulence factor genes. Involved in the proteolytic processing of AgrD, the precursor of AIP. {ECO:0000255|HAMAP-Rule:MF_00784}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Transmembrane (5) |
| Keywords | Cell membrane;Hydrolase;Membrane;Protease;Quorum sensing;Transmembrane;Transmembrane helix;Virulence |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cell membrane {ECO:0000255|HAMAP-Rule:MF_00784}; Multi-pass membrane protein {ECO:0000255|HAMAP-Rule:MF_00784}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 21,930 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |