| IED ID | IndEnz0002016590 |
| Enzyme Type ID | protease016590 |
| Protein Name |
Cardosin-F EC 3.4.23.- Cleaved into: Cardosin-F heavy chain; Cardosin-F light chain Fragments |
| Gene Name | |
| Organism | Cynara cardunculus (Cardoon) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae asterids campanulids Asterales Asteraceae Carduoideae Cardueae Carduinae Cynara Cynara cardunculus (Cardoon) |
| Enzyme Sequence | ADSGSAVVALTNDRDTSYYGEIGIGTPPQKFTVIFDTGSSVLWVPSSKAHSMYESSGSSTYKSQDSVTIGDLVVKEQDFIEATEEADNVFLNRLFDGILGLSFQTISVPVWYNMLNQGLVKRFSFWLNRNVDEEEGGELVFGGLDPNHFRGDHTYVPVTYQYYWQFGIGDVLIGDKSTGFCAPGCQAFADSGTSLLSGPTAIVTQINHAIGANGSEELNVKFGLTPEQYILKGEATQCISGFTAMDATLLGPLWILGDVFMRPYHTVFDYGNLLVGFAEAA |
| Enzyme Length | 281 |
| Uniprot Accession Number | P85137 |
| Absorption | |
| Active Site | ACT_SITE 36; /evidence="ECO:0000250|UniProtKB:P42210, ECO:0000255|PROSITE-ProRule:PRU10094"; ACT_SITE 190; /evidence="ECO:0000250|UniProtKB:P42210, ECO:0000255|PROSITE-ProRule:PRU10094" |
| Activity Regulation | ACTIVITY REGULATION: Inhibited by pepstatin. {ECO:0000269|PubMed:19488781}. |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.23.- |
| Enzyme Function | FUNCTION: Aspartic protease with a high preference for bonds between hydrophobic residues. {ECO:0000269|PubMed:19488781}. |
| Temperature Dependency | |
| PH Dependency | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimim pH is 4.3. Active from pH 3 to 6.5. {ECO:0000269|PubMed:19488781}; |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Chain (2); Disulfide bond (2); Domain (1); Glycosylation (1); Non-adjacent residues (5); Non-terminal residue (1) |
| Keywords | Aspartyl protease;Cell wall;Direct protein sequencing;Disulfide bond;Endoplasmic reticulum;Extracellular matrix;Glycoprotein;Hydrolase;Membrane;Microsome;Protease;Secreted;Vacuole;Zymogen |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Microsome membrane {ECO:0000250|UniProtKB:Q9XFX3}. Protein storage vacuole {ECO:0000250|UniProtKB:Q9XFX3}. Secreted, cell wall {ECO:0000250|UniProtKB:Q9XFX3}. Secreted, extracellular space, extracellular matrix {ECO:0000250|UniProtKB:Q9XFX3}. Note=Procardosin-F is associated with the microsomal membranes, the mature form is secreted. {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | PTM: N-glycosylated. {ECO:0000269|PubMed:19488781}. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 30,561 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |