| IED ID | IndEnz0002016639 |
| Enzyme Type ID | protease016639 |
| Protein Name |
Putative AgrB-like protein EC 3.4.-.- |
| Gene Name | BH3475 |
| Organism | Alkalihalobacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) (Bacillus halodurans) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Bacillaceae Alkalihalobacillus Alkalihalobacillus halodurans (Bacillus halodurans) Alkalihalobacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) (Bacillus halodurans) |
| Enzyme Sequence | MLERLALTLAHQVKALNAEETESVEVLTFGFTIILHYLFTLLLVLAVGLLHGEIWLFLQIALSFTFMRVLTGGAHLDHSIGCTLLSVLFITAISWVPFANNYAWILYGISGGLLIWKYAPYYEAHQVVHTEHWERRKKRIAYILIVLFIILAMLMSTQGLVLGVLLQGVLLTPIGLKVTRQLNRFILKGGETNEENS |
| Enzyme Length | 197 |
| Uniprot Accession Number | Q9K794 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.-.- |
| Enzyme Function | FUNCTION: May be involved in the proteolytic processing of a quorum sensing system signal molecule precursor. {ECO:0000255|HAMAP-Rule:MF_00784}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Transmembrane (4) |
| Keywords | Cell membrane;Hydrolase;Membrane;Protease;Quorum sensing;Reference proteome;Transmembrane;Transmembrane helix |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cell membrane {ECO:0000255|HAMAP-Rule:MF_00784}; Multi-pass membrane protein {ECO:0000255|HAMAP-Rule:MF_00784}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 22,233 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |