| IED ID | IndEnz0002016684 |
| Enzyme Type ID | protease016684 |
| Protein Name |
Chymotrypsin-like elastase family member 2A EC 3.4.21.71 Elastase-2 Elastase-2A |
| Gene Name | CELA2A ELA2 ELA2A |
| Organism | Sus scrofa (Pig) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Laurasiatheria Artiodactyla Suina Suidae (pigs) Sus Sus scrofa (Pig) |
| Enzyme Sequence | MIRALLLSTLVAGALSCGLPANLPQLPRVVGGEDARPNSWPWQVSLQYDSSGQWRHTCGGTLVDQSWVLTAAHCISSSRTYRVVLGRHSLSTNEPGSLAVKVSKLVVHQDWNSNQLSNGNDIALLKLASPVSLTDKIQLGCLPAAGTILPNNYVCYVTGWGRLQTNGASPDILQQGQLLVVDYATCSKPGWWGSTVKTNMICAGGDGIISSCNGDSGGPLNCQGANGQWQVHGIVSFGSSLGCNYYHKPSVFTRVSNYIDWINSVIANN |
| Enzyme Length | 269 |
| Uniprot Accession Number | P08419 |
| Absorption | |
| Active Site | ACT_SITE 73; /note=Charge relay system; ACT_SITE 121; /note=Charge relay system; ACT_SITE 216; /note=Charge relay system |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Preferential cleavage: Leu-|-Xaa, Met-|-Xaa and Phe-|-Xaa. Hydrolyzes elastin.; EC=3.4.21.71; Evidence={ECO:0000250|UniProtKB:P08217}; |
| DNA Binding | |
| EC Number | 3.4.21.71 |
| Enzyme Function | FUNCTION: Elastase that enhances insulin signaling and might have a physiologic role in cellular glucose metabolism. Circulates in plasma and reduces platelet hyperactivation, triggers both insulin secretion and degradation, and increases insulin sensitivity. {ECO:0000250|UniProtKB:P08217}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Beta strand (15); Chain (1); Disulfide bond (4); Domain (1); Helix (6); Propeptide (1); Sequence conflict (5); Signal peptide (1); Turn (1) |
| Keywords | 3D-structure;Disulfide bond;Hydrolase;Protease;Reference proteome;Secreted;Serine protease;Signal;Zymogen |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250|UniProtKB:P08217}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..16 |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 1BRU; |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 28,699 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |