| IED ID | IndEnz0002016707 |
| Enzyme Type ID | protease016707 |
| Protein Name |
CASP8 and FADD-like apoptosis regulator Caspase homolog CASH Caspase-eight-related protein Casper Caspase-like apoptosis regulatory protein CLARP Cellular FLICE-like inhibitory protein c-FLIP FADD-like antiapoptotic molecule 1 FLAME-1 Inhibitor of FLICE I-FLICE MACH-related inducer of toxicity MRIT Usurpin Cleaved into: CASP8 and FADD-like apoptosis regulator subunit p43; CASP8 and FADD-like apoptosis regulator subunit p12 |
| Gene Name | Cflar Cash |
| Organism | Mus musculus (Mouse) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) |
| Enzyme Sequence | MAQSPVSAEVIHQVEECLDEDEKEMMLFLCRDVTENLAAPNVRDLLDSLSERGQLSFATLAELLYRVRRFDLLKRILKTDKATVEDHLRRNPHLVSDYRVLLMEIGESLDQNDVSSLVFLTRDYTGRGKIAKDKSFLDLVIELEKLNLIASDQLNLLEKCLKNIHRIDLNTKIQKYTQSSQGARSNMNTLQASLPKLSIKYNSRLQNGRSKEPRFVEYRDSQRTLVKTSIQESGAFLPPHIREETYRMQSKPLGICLIIDCIGNDTKYLQETFTSLGYHIQLFLFPKSHDITQIVRRYASMAQHQDYDSFACVLVSLGGSQSMMGRDQVHSGFSLDHVKNMFTGDTCPSLRGKPKLFFIQNYESLGSQLEDSSLEVDGPSIKNVDSKPLQPRHCTTHPEADIFWSLCTADVSHLEKPSSSSSVYLQKLSQQLKQGRRRPLVDLHVELMDKVYAWNSGVSSKEKYSLSLQHTLRKKLILAPT |
| Enzyme Length | 481 |
| Uniprot Accession Number | O35732 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Apoptosis regulator protein which may function as a crucial link between cell survival and cell death pathways in mammalian cells. Acts as an inhibitor of TNFRSF6 mediated apoptosis. A proteolytic fragment (p43) is likely retained in the death-inducing signaling complex (DISC) thereby blocking further recruitment and processing of caspase-8 at the complex. Full length and shorter isoforms have been shown either to induce apoptosis or to reduce TNFRSF-triggered apoptosis. Lacks enzymatic (caspase) activity (By similarity). {ECO:0000250, ECO:0000269|PubMed:10602037, ECO:0000269|PubMed:10894163}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Alternative sequence (2); Chain (2); Domain (2); Mutagenesis (2); Region (8); Sequence conflict (2); Site (2) |
| Keywords | Alternative splicing;Apoptosis;Reference proteome;Repeat |
| Interact With | |
| Induction | INDUCTION: Isoform 1 but not isoform 2 is activated by BCR cross-linking in primary B-cells. |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | PTM: Proteolytically processed by CASP8 generating subunits p43 and p12. {ECO:0000269|PubMed:31511692}. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 10725249; 11016460; 11217851; 11247636; 11544288; 12135878; 12244156; 12466851; 12477972; 14551207; 14610273; 15282307; 15557152; 15761846; 15815586; 15899875; 15917295; 15972663; 16043517; 16141072; 16263940; 16306425; 16397188; 16469705; 16487007; 16602821; 16783640; 17056040; 17237443; 17372587; 17448907; 17462996; 17464994; 17488888; 17581950; 17699753; 17823262; 17878261; 17975479; 18081036; 18219316; 18356280; 18390734; 18566605; 18708583; 18832693; 19109151; 19285665; 19300454; 19322522; 19373244; 19429865; 19433309; 19587217; 20100735; 20335528; 20427667; 20724542; 20739833; 20980680; 21267068; 21364645; 21368763; 21435442; 21677750; 21703207; 21803845; 21862448; 22089168; 22095280; 22202974; 22393362; 22406316; 22582174; 22675671; 22700824; 23012479; 23144495; 23175183; 23250397; 23313194; 23424201; 23505065; 23828575; 24036366; 24095739; 24209745; 24270411; 24275659; 24557836; 24722293; 24813850; 24952961; 25087120; 25342470; 25500368; 25501600; 25725104; 25746012; 25963626; 26238491; 26582200; 26798068; 27106802; 27267061; 27523270; 27619661; 27819682; 28052242; 28218919; 28850249; 29099934; 29107687; 29191940; 29596938; 30185824; 31132747; 31387178; 31723262; 32103006; 32193329; 33238518; 33269646; 33354276; 34238932; 34545139; 9729047; |
| Motif | |
| Gene Encoded By | |
| Mass | 54,875 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |