| IED ID |
IndEnz0002016718 |
| Enzyme Type ID |
protease016718 |
| Protein Name |
Chemotaxis protein CheY
|
| Gene Name |
cheY |
| Organism |
Yersinia enterocolitica |
| Taxonomic Lineage |
cellular organisms
Bacteria
Proteobacteria
Gammaproteobacteria
Enterobacterales
Yersiniaceae
Yersinia
Yersinia enterocolitica
|
| Enzyme Sequence |
MADKNLRFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLRTGGFDFVVSDWNMPNMDGLDLLKTIRADGALGTLPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM |
| Enzyme Length |
129 |
| Uniprot Accession Number |
Q93P00 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
FUNCTION: Involved in the transmission of sensory signals from the chemoreceptors to the flagellar motors. In its active (phosphorylated or acetylated) form, CheY exhibits enhanced binding to a switch component, FliM, at the flagellar motor which induces a change from counterclockwise to clockwise flagellar rotation (By similarity). {ECO:0000250}. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1); Domain (1); Initiator methionine (1); Metal binding (4); Modified residue (3) |
| Keywords |
Acetylation;Chemotaxis;Cytoplasm;Flagellar rotation;Magnesium;Metal-binding;Phosphoprotein;Two-component regulatory system |
| Interact With |
|
| Induction |
|
| Subcellular Location |
SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250}. |
| Modified Residue |
MOD_RES 57; /note=4-aspartylphosphate; /evidence=ECO:0000255|PROSITE-ProRule:PRU00169; MOD_RES 92; /note=N6-acetyllysine; /evidence=ECO:0000250; MOD_RES 109; /note=N6-acetyllysine; /evidence=ECO:0000250 |
| Post Translational Modification |
PTM: Phosphorylated by CheA or acetylated by acetyl-CoA synthetase, depending on which acetate metabolism pathway is available. {ECO:0000250}. |
| Signal Peptide |
|
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
|
| Mass |
14,164 |
| Kinetics |
|
| Metal Binding |
METAL 12; /note=Magnesium; /evidence=ECO:0000250; METAL 13; /note=Magnesium; /evidence=ECO:0000250; METAL 57; /note=Magnesium; /evidence=ECO:0000250; METAL 59; /note=Magnesium; via carbonyl oxygen; /evidence=ECO:0000250 |
| Rhea ID |
|
| Cross Reference Brenda |
|