| IED ID | IndEnz0002016772 |
| Enzyme Type ID | protease016772 |
| Protein Name |
Angiopoietin-related protein 7 Angiopoietin-like factor Angiopoietin-like protein 7 Cornea-derived transcript 6 protein |
| Gene Name | ANGPTL7 CDT6 UNQ313/PRO356 |
| Organism | Homo sapiens (Human) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Homininae Homo Homo sapiens (Human) |
| Enzyme Sequence | MLKKPLSAVTWLCIFIVAFVSHPAWLQKLSKHKTPAQPQLKAANCCEEVKELKAQVANLSSLLSELNKKQERDWVSVVMQVMELESNSKRMESRLTDAESKYSEMNNQIDIMQLQAAQTVTQTSADAIYDCSSLYQKNYRISGVYKLPPDDFLGSPELEVFCDMETSGGGWTIIQRRKSGLVSFYRDWKQYKQGFGSIRGDFWLGNEHIHRLSRQPTRLRVEMEDWEGNLRYAEYSHFVLGNELNSYRLFLGNYTGNVGNDALQYHNNTAFSTKDKDNDNCLDKCAQLRKGGYWYNCCTDSNLNGVYYRLGEHNKHLDGITWYGWHGSTYSLKRVEMKIRPEDFKP |
| Enzyme Length | 346 |
| Uniprot Accession Number | O43827 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Has a role in the formation and organization of the extracellular matrix. In the eye, it functions as a mediator of dexamethasone-induced matrix deposition in the trabecular meshwork, the tissue responsible for the outflow of the ocular aqueous humor and for the maintenance of intraocular pressure (PubMed:21199193). Is a negative regulator of angiogenesis in the cornea, and plays a major role in maintaining corneal avascularity and transparency (PubMed:25622036). {ECO:0000269|PubMed:21199193, ECO:0000269|PubMed:25622036}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Coiled coil (1); Disulfide bond (2); Domain (1); Glycosylation (3); Natural variant (3); Signal peptide (1) |
| Keywords | Coiled coil;Direct protein sequencing;Disulfide bond;Glycoprotein;Reference proteome;Secreted;Signal |
| Interact With | P35609 |
| Induction | INDUCTION: Expression is up-regulated by dexamethasone. {ECO:0000269|PubMed:16541013}. |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:11682471}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..26; /evidence=ECO:0000269|PubMed:15340161 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 18421092; 24903490; 25854806; 28264047; 31302653; 31962333; 32369491; 32525822; 32786125; 33313310; |
| Motif | |
| Gene Encoded By | |
| Mass | 40,018 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |