| IED ID | IndEnz0002016778 |
| Enzyme Type ID | protease016778 |
| Protein Name |
Serine protease inhibitor 2 ASPI-2 |
| Gene Name | |
| Organism | Anisakis simplex (Herring worm) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Nematoda (roundworms) Chromadorea Rhabditida Spirurina Ascaridomorpha Ascaridoidea Anisakidae Anisakis Anisakis simplex complex Anisakis simplex (Herring worm) |
| Enzyme Sequence | MMFTPLIVLTLLVLATAEHQCGPNEQWSDCPKCELQCGESDKPCATICGEPKCYCSPDKYRRIPDGRCIRKIQCPQH |
| Enzyme Length | 77 |
| Uniprot Accession Number | O77417 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Defends the organism against the host's proteinases. {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (5); Domain (1); Signal peptide (1); Site (1) |
| Keywords | Disulfide bond;Protease inhibitor;Secreted;Serine protease inhibitor;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..17; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 8,699 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |