| IED ID | IndEnz0002016790 |
| Enzyme Type ID | protease016790 |
| Protein Name |
Periplasmic protein CpxP ORF_o167 Periplasmic accessory protein CpxP |
| Gene Name | cpxP yiiO b4484 JW5558 |
| Organism | Escherichia coli (strain K12) |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Escherichia Escherichia coli Escherichia coli (strain K12) |
| Enzyme Sequence | MRIVTAAVMASTLAVSSLSHAAEVGSGDNWHPGEELTQRSTQSHMFDGISLTEHQRQQMRDLMQQARHEQPPVNVSELETMHRLVTAENFDENAVRAQAEKMANEQIARQVEMAKVRNQMYRLLTPEQQAVLNEKHQQRMEQLRDVTQWQKSSSLKLLSSSNSRSQ |
| Enzyme Length | 166 |
| Uniprot Accession Number | P0AE85 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Acts as an auxiliary protein in the Cpx two-component envelope stress response system, helping modulate the Cpx response systems response to some inducers (PubMed:25207645, PubMed:16303867). Binds the periplasmic domain of sensor histidine kinase CpxA, inhibiting induction of the Cpx envelope stress response in the absence of inducer; overexpression decreases Cpx pathway activity (PubMed:16166523, PubMed:21317318). Some periplasmic stimulii (shown for P pili subunit PapE and probably 0.3 M NaCl) increase CpxP's susceptibility to DegP, leading to CpxP degradation, inducing the Cpx pathway (PubMed:16166523, PubMed:16303867). Aids in combating extracytoplasmic protein-mediated toxicity (PubMed:9473036, PubMed:16303867, PubMed:21239493). Overexpression leads to degradation by DegP of misfolded P pili subunits in the periplasm (tested using PapE) (PubMed:21239493). Inhibits autophosphorylation of CpxA in reconstituted liposomes by 50% but has no effect on phosphatase activity of CpxA (PubMed:17259177, PubMed:21239493). Has mild protein chaperone activity (PubMed:21317898, PubMed:21239493). {ECO:0000269|PubMed:16166523, ECO:0000269|PubMed:16303867, ECO:0000269|PubMed:17259177, ECO:0000269|PubMed:21239493, ECO:0000269|PubMed:21317318, ECO:0000269|PubMed:21317898, ECO:0000269|PubMed:25207645, ECO:0000269|PubMed:9473036}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (1); Chain (1); Erroneous initiation (1); Helix (5); Mutagenesis (12); Region (2); Signal peptide (1); Turn (1) |
| Keywords | 3D-structure;Periplasm;Reference proteome;Signal;Stress response |
| Interact With | Itself |
| Induction | INDUCTION: Induced by envelope stress such as overexpression of misfolded periplasmic proteins (PubMed:9351822). Induced by alkaine pH (tested up to pH 8.4) (PubMed:9473036, PubMed:16166523). Induction is decreased in a degP deletion (PubMed:16166523). Transcription is stimulated by the Cpx two-component signal transduction pathway; sigma factor E (rpoE) is not involved (PubMed:9351822, PubMed:9473036, PubMed:10972835). Transcription induced by spheroplasting, which removes the periplasm and thus this protein; if the protein is anchored to the outer surface of the inner membrane induction does not occur (PubMed:10972835). Induced in persister cells (PubMed:16768798). {ECO:0000269|PubMed:10972835, ECO:0000269|PubMed:16166523, ECO:0000269|PubMed:16768798, ECO:0000269|PubMed:9351822, ECO:0000269|PubMed:9473036}. |
| Subcellular Location | SUBCELLULAR LOCATION: Periplasm {ECO:0000269|PubMed:25207645, ECO:0000269|PubMed:9473036}. |
| Modified Residue | |
| Post Translational Modification | PTM: Degraded by DegP; some CpxP mutant proteins are more susceptible to the protease than others (PubMed:16166523). Degradation probably occurs when CpxP is associated with some misfolded proteins; overexpression of PapE leads to DegP-mediated degradation of CpxP and PapE, which requires the N-terminus of PapE. Overexpression of NlpE does not induce this degradation however (PubMed:16303867). {ECO:0000269|PubMed:16166523, ECO:0000269|PubMed:16303867}. |
| Signal Peptide | SIGNAL 1..21; /evidence=ECO:0000255 |
| Structure 3D | X-ray crystallography (2) |
| Cross Reference PDB | 3ITF; 3QZC; |
| Mapped Pubmed ID | 12670966; 14731270; |
| Motif | |
| Gene Encoded By | |
| Mass | 18,965 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |