| IED ID | IndEnz0002016803 |
| Enzyme Type ID | protease016803 |
| Protein Name |
ATP-dependent Clp protease ATP-binding subunit ClpA homolog Fragments |
| Gene Name | |
| Organism | Populus euphratica (Euphrates poplar) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids fabids Malpighiales Salicaceae Saliceae Populus (poplars) Populus euphratica (Euphrates poplar) |
| Enzyme Sequence | GSGFVAVEIPFTPRVLELSLEEARVLENLGADPSNIRFQPVKVPEPSVDETIQILKFLPDKAIDLIDEAGSR |
| Enzyme Length | 72 |
| Uniprot Accession Number | P84565 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: May interact with a ClpP-like protease involved in degradation of denatured proteins in the chloroplast. {ECO:0000305}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Non-adjacent residues (4); Non-terminal residue (2) |
| Keywords | ATP-binding;Chaperone;Chloroplast;Direct protein sequencing;Nucleotide-binding;Plastid |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Plastid, chloroplast {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 7,888 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |