| IED ID | IndEnz0002016928 |
| Enzyme Type ID | protease016928 |
| Protein Name |
ATP-dependent protease subunit ClpQ EC 3.4.21.- |
| Gene Name | clpQ hslV RBAM_015980 |
| Organism | Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / FZB42) (Bacillus amyloliquefaciens subsp. plantarum) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus subtilis group Bacillus amyloliquefaciens group Bacillus velezensis Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / FZB42) (Bacillus amyloliquefaciens subsp. plantarum) |
| Enzyme Sequence | MSSFHATTIFAVQHNGKSAMSGDGQVTFGQAVVMKHTARKVRKLFNGKVLAGFAGSVADAFTLFEMFEAKLEEYNGNLKRASVELAKEWRSDKVLRKLEAMLIVMNQDTLLLVSGTGEVIEPDDGILAIGSGGNYALSAGRALKTYAGENLSAKDIAKAALKIAGEICVYTNDQIILEELE |
| Enzyme Length | 181 |
| Uniprot Accession Number | A7Z4N5 |
| Absorption | |
| Active Site | ACT_SITE 2; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.21.- |
| Enzyme Function | FUNCTION: Protease subunit of a proteasome-like degradation complex. {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Initiator methionine (1); Metal binding (3) |
| Keywords | Cytoplasm;Hydrolase;Metal-binding;Protease;Serine protease;Sodium |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 19,489 |
| Kinetics | |
| Metal Binding | METAL 165; /note=Sodium; via carbonyl oxygen; /evidence=ECO:0000250; METAL 168; /note=Sodium; via carbonyl oxygen; /evidence=ECO:0000250; METAL 171; /note=Sodium; via carbonyl oxygen; /evidence=ECO:0000250 |
| Rhea ID | |
| Cross Reference Brenda |