| IED ID | IndEnz0002016930 |
| Enzyme Type ID | protease016930 |
| Protein Name |
ATP-dependent Clp protease proteolytic subunit-related protein 1, chloroplastic ClpR1 Protein SUPPRESSOR OF VARIEGATION 2 nClpP5 |
| Gene Name | CLPR1 NCLPP5 SVR2 At1g49970 F2J10.14 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MATALVSPLTSQLNHEAVCSKFVLPKSPFMSGSKLFSSNMPCSTVPRRTRRSHCFASAKDMSFDHIPKQFRGDNLKDGVMQNFKNVPQYFYGLNSAQMDMFMTEDSPVRRQAEKVTEESISSRNNYLNNGGIWSMSGMNAADARRYSMSVQMYRGGGGGGGSERPRTAPPDLPSLLLDARICYLGMPIVPAVTELLVAQFMWLDYDNPTKPIYLYINSPGTQNEKMETVGSETEAYAIADTISYCKSDVYTINCGMAFGQAAMLLSLGKKGYRAVQPHSSTKLYLPKVNRSSGAAIDMWIKAKELDANTEYYIELLAKGTGKSKEQINEDIKRPKYLQAQAAIDYGIADKIADSQDSSFEKRDYDGTLAQRAMRPGGGSPAAPAGLR |
| Enzyme Length | 387 |
| Uniprot Accession Number | Q9XJ35 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Required for chloroplast development and differentiation. {ECO:0000269|PubMed:17009084, ECO:0000269|PubMed:18599582}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Region (1); Transit peptide (1) |
| Keywords | Chloroplast;Direct protein sequencing;Plastid;Reference proteome;Transit peptide |
| Interact With | |
| Induction | INDUCTION: Repressed in darkness. Accumulates during leaf senescence. {ECO:0000269|PubMed:10427773}. |
| Subcellular Location | SUBCELLULAR LOCATION: Plastid, chloroplast stroma {ECO:0000269|PubMed:10427773, ECO:0000269|PubMed:14593120}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 12185496; 14576160; 16207701; 16895613; 17181860; 18431481; 18469163; 19525416; 23548781; 25102851; 28627464; 32663165; |
| Motif | |
| Gene Encoded By | |
| Mass | 42,627 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |