| IED ID |
IndEnz0002017012 |
| Enzyme Type ID |
protease017012 |
| Protein Name |
ATP-dependent Clp protease adapter protein ClpS
|
| Gene Name |
clpS BceJ2315_26700 BCAL2731 |
| Organism |
Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) (Burkholderia cepacia (strain J2315)) |
| Taxonomic Lineage |
cellular organisms
Bacteria
Proteobacteria
Betaproteobacteria
Burkholderiales
Burkholderiaceae
Burkholderia
Burkholderia cepacia complex
Burkholderia cenocepacia
Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) (Burkholderia cepacia (strain J2315))
|
| Enzyme Sequence |
MAIIPDKQDSTVLERKQQKLKPPSMYKVVLLNDDFTPMEFVVMVVQEYFKKDRETATQIMLKVHREGRGVCGVYTRDIASTKVEQVVTHARQAGHPLQCVMEEA |
| Enzyme Length |
104 |
| Uniprot Accession Number |
B4E904 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
FUNCTION: Involved in the modulation of the specificity of the ClpAP-mediated ATP-dependent protein degradation. {ECO:0000255|HAMAP-Rule:MF_00302}. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1) |
| Keywords |
|
| Interact With |
|
| Induction |
|
| Subcellular Location |
|
| Modified Residue |
|
| Post Translational Modification |
|
| Signal Peptide |
|
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
|
| Mass |
11,936 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|