| IED ID |
IndEnz0002017047 |
| Enzyme Type ID |
protease017047 |
| Protein Name |
ATP-dependent Clp protease adapter protein ClpS
|
| Gene Name |
clpS CV_3668 |
| Organism |
Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) |
| Taxonomic Lineage |
cellular organisms
Bacteria
Proteobacteria
Betaproteobacteria
Neisseriales
Chromobacteriaceae
Chromobacterium group
Chromobacterium
Chromobacterium violaceum
Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757)
|
| Enzyme Sequence |
MKVDMSTSVKDDAQLEASRVRENPPPMYKVLLLNDDFTPMDFVVQVLQQFFHMNREKATHIMLQVHTQGHGVCGVYTKDVAATKVEQVLQYAKAHQHPLQCVMEEN |
| Enzyme Length |
106 |
| Uniprot Accession Number |
Q7NRW1 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
FUNCTION: Involved in the modulation of the specificity of the ClpAP-mediated ATP-dependent protein degradation. {ECO:0000255|HAMAP-Rule:MF_00302}. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1); Compositional bias (1); Region (1) |
| Keywords |
Reference proteome |
| Interact With |
|
| Induction |
|
| Subcellular Location |
|
| Modified Residue |
|
| Post Translational Modification |
|
| Signal Peptide |
|
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
|
| Mass |
12,156 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|