| IED ID |
IndEnz0002017053 |
| Enzyme Type ID |
protease017053 |
| Protein Name |
ATP-dependent Clp protease adapter protein ClpS
|
| Gene Name |
clpS cauri_2102 |
| Organism |
Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CIP 107346 / CN-1) (Corynebacterium nigricans) |
| Taxonomic Lineage |
cellular organisms
Bacteria
Terrabacteria group
Actinobacteria
Actinomycetia (high G+C Gram-positive bacteria)
Corynebacteriales
Corynebacteriaceae
Corynebacterium
Corynebacterium aurimucosum
Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CIP 107346 / CN-1) (Corynebacterium nigricans)
|
| Enzyme Sequence |
MKAHKETSAGVVMSSPMATPELDEAIEVDVATSENLPWMCIVWDDPVNLMSYVSYVFQTVLGYDKKRANELMMQVHTEGKAAVSSGERDKVEADVKKLQVAGLWATMQQAG |
| Enzyme Length |
111 |
| Uniprot Accession Number |
C3PIP1 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
FUNCTION: Involved in the modulation of the specificity of the ClpAP-mediated ATP-dependent protein degradation. {ECO:0000255|HAMAP-Rule:MF_00302}. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1) |
| Keywords |
Reference proteome |
| Interact With |
|
| Induction |
|
| Subcellular Location |
|
| Modified Residue |
|
| Post Translational Modification |
|
| Signal Peptide |
|
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
|
| Mass |
12,222 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|