| IED ID |
IndEnz0002017075 |
| Enzyme Type ID |
protease017075 |
| Protein Name |
ATP-dependent Clp protease adapter protein ClpS
|
| Gene Name |
clpS Dde_2100 |
| Organism |
Desulfovibrio alaskensis (strain ATCC BAA 1058 / DSM 17464 / G20) (Desulfovibrio desulfuricans (strain G20)) |
| Taxonomic Lineage |
cellular organisms
Bacteria
Proteobacteria
delta/epsilon subdivisions
Deltaproteobacteria
Desulfovibrionales
Desulfovibrionaceae
Desulfovibrio
Desulfovibrio alaskensis
Desulfovibrio alaskensis (strain ATCC BAA 1058 / DSM 17464 / G20) (Desulfovibrio desulfuricans (strain G20))
|
| Enzyme Sequence |
MSDRKLSTREDADVLLEEELKEPRRFRVLLHNDDYTSMDFVVAVLIDIFRKSREQAMSIMLSVHEKGIGVCGVYTAEVAETKVAMVHARARAEGFPLRCSMEEV |
| Enzyme Length |
104 |
| Uniprot Accession Number |
Q30ZJ9 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
FUNCTION: Involved in the modulation of the specificity of the ClpAP-mediated ATP-dependent protein degradation. {ECO:0000255|HAMAP-Rule:MF_00302}. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1) |
| Keywords |
Reference proteome |
| Interact With |
|
| Induction |
|
| Subcellular Location |
|
| Modified Residue |
|
| Post Translational Modification |
|
| Signal Peptide |
|
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
|
| Mass |
11,875 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|