| IED ID | IndEnz0002017111 |
| Enzyme Type ID | protease017111 |
| Protein Name |
2S albumin-like cysteine protease inhibitor AaCI-2S Fragments |
| Gene Name | |
| Organism | Araucaria angustifolia (Brazilian pine tree) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Acrogymnospermae Pinopsida Pinidae Conifers II Araucariaceae Araucaria Araucaria angustifolia (Brazilian pine tree) |
| Enzyme Sequence | ERRCDPRRLSDCEDFVRGRSKGGRGEKECRLSERCCTELQKMPRECRCEAVEGMYKEAERKERGEGEQRQRLERARALPGLCSIEPSYCEIRPS |
| Enzyme Length | 94 |
| Uniprot Accession Number | C0HLT8 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Cysteine protease inhibitor that likely functions in defense against insects by inhibiting cysteine proteases in the midgut of herbivore insects such as C.maculatus (PubMed:33266031). Selectively inhibits cathepsin L, as well as papain, ficin and bromelain with lower efficiency (PubMed:33266031). Shows antitumor activity, inhibiting the growth of prostate cancer cell lines PC3 and DU145, and the gastric cancer cell line Hs746T (PubMed:33266031). No activity against cathepsin B or serine proteases (trypsin, human plasma kallikrein and elastase) (PubMed:33266031). {ECO:0000269|PubMed:33266031}. |
| Temperature Dependency | BIOPHYSICOCHEMICAL PROPERTIES: Temperature dependence: Thermostable. Active from 25 to 100 degrees Celsius. Retains 80% of its maximal activity after heating for 2 hours at 100 degrees and retains around 30% of its maximal activity after heating for 4 hours at 100 degrees. {ECO:0000269|PubMed:33266031}; |
| PH Dependency | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH is around 6. Stable from pH 2 to 10. {ECO:0000269|PubMed:33266031}; |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (3); Non-adjacent residues (2); Non-terminal residue (2) |
| Keywords | Direct protein sequencing;Disulfide bond;Protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 11,012 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |