| IED ID |
IndEnz0002017233 |
| Enzyme Type ID |
protease017233 |
| Protein Name |
ATP-dependent Clp protease adapter protein ClpS
|
| Gene Name |
clpS plu1593 |
| Organism |
Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) |
| Taxonomic Lineage |
cellular organisms
Bacteria
Proteobacteria
Gammaproteobacteria
Enterobacterales
Morganellaceae
Photorhabdus
Photorhabdus laumondii
Photorhabdus luminescens subsp. laumondii
Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
|
| Enzyme Sequence |
MNEYHNSLKSKESVKDERQQKLQPPSMYQVILNNDDYTPMEFVVDVLRKFFSYDIERATQLMLDVHYQGKAVCGVYTAEVAETKAAQVNMYAKEYGHPLLCTLEKV |
| Enzyme Length |
106 |
| Uniprot Accession Number |
Q7N6F7 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
FUNCTION: Involved in the modulation of the specificity of the ClpAP-mediated ATP-dependent protein degradation. {ECO:0000255|HAMAP-Rule:MF_00302}. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1); Compositional bias (1); Region (1) |
| Keywords |
Reference proteome |
| Interact With |
|
| Induction |
|
| Subcellular Location |
|
| Modified Residue |
|
| Post Translational Modification |
|
| Signal Peptide |
|
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
|
| Mass |
12,314 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|