| IED ID |
IndEnz0002017414 |
| Enzyme Type ID |
protease017414 |
| Protein Name |
ATP-dependent Clp protease adapter protein ClpS
|
| Gene Name |
clpS SCO2916 SCE19A.16c |
| Organism |
Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) |
| Taxonomic Lineage |
cellular organisms
Bacteria
Terrabacteria group
Actinobacteria
Actinomycetia (high G+C Gram-positive bacteria)
Streptomycetales
Streptomycetaceae
Streptomyces
Streptomyces albidoflavus group
Streptomyces coelicolor
Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
|
| Enzyme Sequence |
MEIEKTESAEEVFAVPEPDVPWVTIVHNDPVNLMSYVTYVFQSYFGYSKDKATKLMMDVHHKGRAVVSSGSREEMERDVQAMHGYGLWATLQQDRK |
| Enzyme Length |
96 |
| Uniprot Accession Number |
Q9S2G5 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
FUNCTION: Involved in the modulation of the specificity of the ClpAP-mediated ATP-dependent protein degradation. {ECO:0000255|HAMAP-Rule:MF_00302}. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1); Erroneous initiation (1) |
| Keywords |
Reference proteome |
| Interact With |
|
| Induction |
|
| Subcellular Location |
|
| Modified Residue |
|
| Post Translational Modification |
|
| Signal Peptide |
|
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
|
| Mass |
11,054 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|