| IED ID | IndEnz0002017551 |
| Enzyme Type ID | protease017551 |
| Protein Name |
ATP-dependent Clp protease ATP-binding subunit CLPT1, chloroplastic nClpC-like protein |
| Gene Name | CLPT1 CLPS1 At4g25370 T30C3.40 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MASYTVSFIPLTLSNPRIFVSRQNGSPSSSSRIPLTSSLLGKKLLATQPSHRCFVPKLRCLTSASTVLNVPIAQPENGSSDKIPKWSARAIKSLAMGELEARKLKYPSTGTEAILMGILVEGTSTVAKFLRGNGVTLFKVRDETLSLLGKSDMYFFSPEHPPLTEPAQKAIAWAIDEKNKSDVDGELTTAYLLLGVWSQKDSAGRQILEKLGFNEDKAKEVEKSMNEDVDLSFKKQGQ |
| Enzyme Length | 238 |
| Uniprot Accession Number | Q93WL3 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Accessory protein regulating the assembly of the plastidial Clp protease system (PubMed:21266658, PubMed:25921872). CLPT1 first binds to the heptameric P-ring containing the CLP3-6 subunits followed by CLPT2, and only then does the P-ring combine with the R-ring composed of the clpP1 and CLPR1-4 subunits (PubMed:21266658). Once the core complex is fully assembled, it then associates to the CLPC chaperone partner to form the functional protease (PubMed:21266658). CLPT1 and CLPT2 are partially redundant (PubMed:25921872). {ECO:0000269|PubMed:21266658, ECO:0000269|PubMed:25921872}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (2); Chain (1); Domain (1); Erroneous gene model prediction (2); Helix (8); Mutagenesis (3); Region (2); Transit peptide (1) |
| Keywords | 3D-structure;Chloroplast;Plastid;Reference proteome;Repeat;Transit peptide |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Plastid, chloroplast {ECO:0000269|PubMed:11278690, ECO:0000269|PubMed:14593120}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 4Y0B; |
| Mapped Pubmed ID | 11826309; 12185496; 12938931; 14576160; 15028209; 16207701; 16766689; 17181860; 18431481; 18633119; 28627464; 29401302; 32663165; |
| Motif | |
| Gene Encoded By | |
| Mass | 26,050 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |