| IED ID | IndEnz0002018335 |
| Enzyme Type ID | protease018335 |
| Protein Name |
Transcriptional regulator ClgR ClpR-like regulator clp gene regulator |
| Gene Name | clgR Rv2745c |
| Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Actinobacteria Actinomycetia (high G+C Gram-positive bacteria) Corynebacteriales Mycobacteriaceae Mycobacterium Mycobacterium tuberculosis complex Mycobacterium tuberculosis Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Enzyme Sequence | MAALVREVVGDVLRGARMSQGRTLREVSDSARVSLGYLSEIERGRKEPSSELLSAICTALQLPLSVVLIDAGERMARQERLARATPAGRATGATIDASTKVVIAPVVSLAVA |
| Enzyme Length | 112 |
| Uniprot Accession Number | P9WMH7 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | DNA_BIND 24..43; /note=H-T-H motif; /evidence=ECO:0000255|PROSITE-ProRule:PRU00257 |
| EC Number | |
| Enzyme Function | FUNCTION: Key stress-response regulator that plays an important role in multiple regulatory networks in response to different stress conditions (PubMed:20688819, PubMed:25899163). Involved in preservation of envelope integrity and tolerance to surface stress (PubMed:25899163). Essential for macrophage infection and facilitates intracellular growth of M.tuberculosis (PubMed:25899163, PubMed:20688819). Controls the expression of several protease and chaperone systems, including clpP1, clpP2, clpC1, ptrB, Rv1043c, acr2, clpB, Rv3269 and the clgR-pspA-rv2743c-rv2742c region (PubMed:20688819, PubMed:25899163, PubMed:23560081). Also plays an essential role in RecA/LexA-independent DNA repair mechanism by inducing expression of DNA repair genes in response to DNA damage (PubMed:21771781). {ECO:0000269|PubMed:20688819, ECO:0000269|PubMed:21771781, ECO:0000269|PubMed:23560081, ECO:0000269|PubMed:25899163}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); DNA binding (1); Domain (1) |
| Keywords | DNA-binding;Reference proteome;Stress response;Transcription;Transcription regulation |
| Interact With | |
| Induction | INDUCTION: Expression requires SigE (PubMed:11489128, PubMed:25899163). Induced by carbonyl cyanide m-chlorophenyl hydrazone (CCCP) (PubMed:25899163). Induced in response to thioridazine (THZ) (PubMed:20386700). {ECO:0000269|PubMed:11489128, ECO:0000269|PubMed:20386700, ECO:0000269|PubMed:25899163}. |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 11,786 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |