| IED ID | IndEnz0002018368 |
| Enzyme Type ID | protease018368 |
| Protein Name |
ATP-dependent Clp protease proteolytic subunit 4, chloroplastic EC 3.4.21.92 Endopeptidase ClpP4 nClpP4 nClpP3 |
| Gene Name | CLPP4 NCLPP3 NCLPP4 At5g45390 MFC19.5 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MGTLSLSSSLKPSLVSSRLNSSSSASSSSFPKPNNLYLKPTKLISPPLRTTSPSPLRFANASIEMSQTQESAIRGAESDVMGLLLRERIVFLGSSIDDFVADAIMSQLLLLDAKDPKKDIKLFINSPGGSLSATMAIYDVVQLVRADVSTIALGIAASTASIILGAGTKGKRFAMPNTRIMIHQPLGGASGQAIDVEIQAKEVMHNKNNVTSIIAGCTSRSFEQVLKDIDRDRYMSPIEAVEYGLIDGVIDGDSIIPLEPVPDRVKPRVNYEEISKDPMKFLTPEIPDDEIY |
| Enzyme Length | 292 |
| Uniprot Accession Number | Q94B60 |
| Absorption | |
| Active Site | ACT_SITE 158; /note=Nucleophile; /evidence=ECO:0000250; ACT_SITE 183; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Hydrolysis of proteins to small peptides in the presence of ATP and magnesium. Alpha-casein is the usual test substrate. In the absence of ATP, only oligopeptides shorter than five residues are hydrolyzed (such as succinyl-Leu-Tyr-|-NHMec, and Leu-Tyr-Leu-|-Tyr-Trp, in which cleavage of the -Tyr-|-Leu- and -Tyr-|-Trp bonds also occurs).; EC=3.4.21.92; |
| DNA Binding | |
| EC Number | 3.4.21.92 |
| Enzyme Function | FUNCTION: Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins (By similarity). Essential protein required for chloroplast development and integrity (PubMed:16705403, PubMed:17241447). Essential for Embryogenesis (PubMed:23548781). {ECO:0000250, ECO:0000269|PubMed:16705403, ECO:0000269|PubMed:17241447, ECO:0000269|PubMed:23548781}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Chain (1); Erroneous gene model prediction (1); Erroneous initiation (2); Modified residue (1); Sequence conflict (5); Transit peptide (1) |
| Keywords | Acetylation;Chloroplast;Direct protein sequencing;Hydrolase;Plastid;Protease;Reference proteome;Serine protease;Transit peptide;Ubl conjugation |
| Interact With | |
| Induction | INDUCTION: Repressed in darkness. Levels decrease in leaves during aging (at protein level). Slightly and transiently repressed by high light stress (at protein level). {ECO:0000269|PubMed:10427773, ECO:0000269|PubMed:11982939, ECO:0000269|PubMed:16705403}. |
| Subcellular Location | SUBCELLULAR LOCATION: Plastid, chloroplast stroma {ECO:0000269|PubMed:11982939, ECO:0000269|PubMed:14593120}. |
| Modified Residue | MOD_RES 66; /note=N-acetylserine; /evidence=ECO:0007744|PubMed:22223895 |
| Post Translational Modification | PTM: Ubiquitinated by CHIP. {ECO:0000269|PubMed:17241447}. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 12185496; 12938931; 14576160; 15028209; 16207701; 16548064; 16640601; 16648217; 16895613; 17181860; 18431481; 18633119; 21166475; 24529374; 26085677; 27247031; 28627464; 29155321; |
| Motif | |
| Gene Encoded By | |
| Mass | 31,498 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |