| IED ID | IndEnz0002018462 |
| Enzyme Type ID | protease018462 |
| Protein Name |
Cystatin-SN Cystain-SA-I Cystatin-1 Salivary cystatin-SA-1 |
| Gene Name | CST1 |
| Organism | Homo sapiens (Human) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Homininae Homo Homo sapiens (Human) |
| Enzyme Sequence | MAQYLSTLLLLLATLAVALAWSPKEEDRIIPGGIYNADLNDEWVQRALHFAISEYNKATKDDYYRRPLRVLRARQQTVGGVNYFFDVEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSFEIYEVPWENRRSLVKSRCQES |
| Enzyme Length | 141 |
| Uniprot Accession Number | P01037 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Human saliva appears to contain several cysteine proteinase inhibitors that are immunologically related to cystatin S but that differ in their specificity due to amino acid sequence differences. Cystatin SN, with a pI of 7.5, is a much better inhibitor of papain and dipeptidyl peptidase I than is cystatin S, although both inhibit ficin equally well. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (2); Motif (1); Natural variant (5); Signal peptide (1); Site (1) |
| Keywords | Direct protein sequencing;Disulfide bond;Protease inhibitor;Reference proteome;Secreted;Signal;Thiol protease inhibitor |
| Interact With | Q12797-6; P67870; Q9Y5U9; O43765; Q9UHD9 |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:20189825}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..20; /evidence="ECO:0000269|PubMed:11788998, ECO:0000269|PubMed:15340161, ECO:0000269|PubMed:1778989" |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 15829315; 17353931; 19343046; 19463800; 19513549; 19587831; 21636832; 23950865; 25416956; 25577248; 25648368; 27764212; 28383558; 28523467; 28633877; 29698614; 29845224; 30012514; 30974106; 30976812; 31106426; 31115563; 33675819; |
| Motif | MOTIF 76..80; /note=Secondary area of contact |
| Gene Encoded By | |
| Mass | 16,388 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |