| IED ID | IndEnz0002018463 |
| Enzyme Type ID | protease018463 |
| Protein Name |
Cystatin-B Stefin-B |
| Gene Name | CSTB STFB |
| Organism | Pan troglodytes (Chimpanzee) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Homininae Pan (chimpanzees) Pan troglodytes (Chimpanzee) |
| Enzyme Sequence | MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEEFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF |
| Enzyme Length | 98 |
| Uniprot Accession Number | Q8I030 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: This is an intracellular thiol proteinase inhibitor. Tightly binding reversible inhibitor of cathepsins L, H and B (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Modified residue (1); Motif (1); Site (1) |
| Keywords | Acetylation;Cytoplasm;Nucleus;Protease inhibitor;Reference proteome;Thiol protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250}. Nucleus {ECO:0000250}. |
| Modified Residue | MOD_RES 1; /note="N-acetylmethionine"; /evidence="ECO:0000250|UniProtKB:P25417, ECO:0000305" |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | MOTIF 46..50; /note=Secondary area of contact; /evidence=ECO:0000250 |
| Gene Encoded By | |
| Mass | 11,154 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |