| IED ID | IndEnz0002018512 |
| Enzyme Type ID | protease018512 |
| Protein Name |
Gilatoxin GTX EC 3.4.21.- Kallikrein-2 |
| Gene Name | |
| Organism | Heloderma horridum horridum (Mexican beaded lizard) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Sauropsida Sauria (diapsids) Lepidosauria (lepidosaurs) Squamata (squamates) Bifurcata (split-tongued squamates) Unidentata Episquamata Toxicofera Anguimorpha (anguimorph lizards) Neoanguimorpha (New World anguimorph lizards) Helodermatidae (beaded lizards) Heloderma Heloderma horridum (Mexican beaded lizard) Heloderma horridum horridum (Mexican beaded lizard) |
| Enzyme Sequence | IIGGQECDETGHPWLALLHRSEGSTCSGVLLNQDWIVTAAHCFYLGELRIGLGVHNRRVLRGNEQVRVSARKKCYPATASIITNSSCSEYTDDIMLIKLDSSVEYTERVRPLSLPTSPASEGAECTVMGWGTTTPPDVTYPAVPVCVRIEMLNNAVCELARDLWNITDSVLCAGTWFGGKDSCKGDSGGPLICRGQLTGIVSWGGFPCEQPLEYGVYTKVISFLFWIQSI |
| Enzyme Length | 230 |
| Uniprot Accession Number | P43685 |
| Absorption | |
| Active Site | ACT_SITE 41; /note=Charge relay system; /evidence=ECO:0000250; ACT_SITE 93; /note=Charge relay system; /evidence=ECO:0000250; ACT_SITE 187; /note=Charge relay system; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.21.- |
| Enzyme Function | FUNCTION: Has kallikrein-like activity, releases bradykinin from kininogen. Catalyzes the hydrolysis of various arginine ester substrates for trypsin and thrombin and degrades both angiotensin I and II by cleavage of the dipeptide Asp-Arg from the NH2-terminal end. Fibrinogen is also degraded but a fibrin clot is not produced. May have a potentiating effect on potent hemorrhagic toxins present in the venom. {ECO:0000269|PubMed:8408054}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Chain (1); Disulfide bond (5); Domain (1); Glycosylation (1); Sequence conflict (25) |
| Keywords | Direct protein sequencing;Disulfide bond;Glycoprotein;Hydrolase;Protease;Secreted;Serine protease;Toxin |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | PTM: Extensively glycosylated, contains approximately 8 mol of monosaccharide per mol of toxin. {ECO:0000269|PubMed:8408054}. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 25,111 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |