| IED ID | IndEnz0002018522 |
| Enzyme Type ID | protease018522 |
| Protein Name |
Alpha-1-antitrypsin 1-1 AAT Alpha-1 protease inhibitor 1 Alpha-1-antiproteinase Serine protease inhibitor 1-1 Serine protease inhibitor A1a Serpin A1a |
| Gene Name | Serpina1a Dom1 Spi1-1 |
| Organism | Mus musculus (Mouse) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) |
| Enzyme Sequence | MTPSISWGLLLLAGLCCLVPSFLAEDVQETDTSQKDQSPASHEIATNLGDFAISLYRELVHQSNTSNIFFSPVSIATAFAMLSLGSKGDTHTQILEGLQFNLTQTSEADIHKSFQHLLQTLNRPDSELQLSTGNGLFVNNDLKLVEKFLEEAKNHYQAEVFSVNFAESEEAKKVINDFVEKGTQGKIAEAVKKLDQDTVFALANYILFKGKWKKPFDPENTEEAEFHVDESTTVKVPMMTLSGMLHVHHCSTLSSWVLLMDYAGNATAVFLLPDDGKMQHLEQTLSKELISKFLLNRRRRLAQIHFPRLSISGEYNLKTLMSPLGITRIFNNGADLSGITEENAPLKLSQAVHKAVLTIDETGTEAAAVTVLQMVPMSMPPILRFDHPFLFIIFEEHTQSPIFLGKVVDPTHK |
| Enzyme Length | 413 |
| Uniprot Accession Number | P07758 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Inhibitor of serine proteases. Its primary target is elastase, but it also has a moderate affinity for plasmin and thrombin. {ECO:0000269|PubMed:11961105, ECO:0000269|PubMed:8619829}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Glycosylation (3); Region (1); Sequence conflict (17); Signal peptide (1); Site (1) |
| Keywords | Acute phase;Glycoprotein;Protease inhibitor;Reference proteome;Secreted;Serine protease inhibitor;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:11961105, ECO:0000269|PubMed:8619829}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..24; /evidence=ECO:0000250 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 10491283; 10515791; 15795238; 16432201; 17635928; 18554416; 21267068; 21505264; 21574874; 21670848; 22159717; 22203983; 22919586; 22949661; 23104507; 24743137; 24848503; 25757566; 26295339; 27232337; 27515817; 28071719; 28121484; 31097772; 32699098; 33539438; 33611166; 34192300; 6375655; 9685498; |
| Motif | |
| Gene Encoded By | |
| Mass | 46,003 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |