| IED ID | IndEnz0002018526 |
| Enzyme Type ID | protease018526 |
| Protein Name |
Ataxin-3 homolog EC 3.4.19.12 MJD1a-like Machado-Joseph disease-like protein |
| Gene Name | At3g54130 F24B22.90 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MERTSNGGMLYHEVQESNLCAVHCVNTVLQGPFFSEFDLAAVAADLDGKERQVMLEGAAVGGFAPGDFLAEESHNVSLGGDFSIQVLQKALEVWDLQVIPLNCPDAEPAQIDPELESAFICHLHDHWFCIRKVNGEWYNFDSLLAAPQHLSKFYLSAFLDSLKGAGWSIFIVKGNFPQECPMSSSSEASNSFGQWLSPEDAERIRKNTSSGSSARNKRSNDNVNQQRRNQALSREEVQAFSEMEDDDLKAAIAASLLDASAAEANLGAVGTSEKETEKQK |
| Enzyme Length | 280 |
| Uniprot Accession Number | Q9M391 |
| Absorption | |
| Active Site | ACT_SITE 20; /note=Nucleophile; /evidence=ECO:0000255|PROSITE-ProRule:PRU00331; ACT_SITE 126; /note=Proton acceptor; /evidence=ECO:0000255|PROSITE-ProRule:PRU00331; ACT_SITE 141; /evidence=ECO:0000255|PROSITE-ProRule:PRU00331 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).; EC=3.4.19.12; |
| DNA Binding | |
| EC Number | 3.4.19.12 |
| Enzyme Function | FUNCTION: Interacts with key regulators of transcription and represses transcription. Acts as a histone-binding protein that regulates transcription. Acts as a deubiquitinating enzyme (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Chain (1); Compositional bias (1); Domain (2); Region (1) |
| Keywords | Hydrolase;Nucleus;Protease;Reference proteome;Thiol protease;Transcription;Transcription regulation;Ubl conjugation pathway |
| Interact With | A0A178W4W9; Q42569; Q39085 |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Nucleus {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 18315867; 18650403; 18775970; 20736450; |
| Motif | |
| Gene Encoded By | |
| Mass | 30,692 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |