| IED ID | IndEnz0002018554 |
| Enzyme Type ID | protease018554 |
| Protein Name |
Bradykinin-potentiating and C-type natriuretic peptides BPP-CNP Cleaved into: Bradykinin-potentiating peptide Tf1; Bradykinin-potentiating peptide Tf2; Bradykinin-potentiating peptide Tf3; C-type natriuretic peptide Tf-CNP; C-type natriuretic peptide Tf-CNP 3-22 ; C-type natriuretic peptide Tf-CNP 6-22 |
| Gene Name | |
| Organism | Protobothrops flavoviridis (Habu) (Trimeresurus flavoviridis) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Sauropsida Sauria (diapsids) Lepidosauria (lepidosaurs) Squamata (squamates) Bifurcata (split-tongued squamates) Unidentata Episquamata Toxicofera Serpentes (snakes) Colubroidea Viperidae Crotalinae (pit vipers) Protobothrops Protobothrops flavoviridis (Habu) (Trimeresurus flavoviridis) |
| Enzyme Sequence | MFVSRLAASGLLLLALLALSLDGKPVHQSKPGRSPPISPLSAQQWMPEGRPPHPIPPLSVQQWSQGRPRSEVPPVVVQPHESPAGGTTAFREELSPGPEAASGPAAPHRLPKSKGASATSAASRPMRDLRTDGKQERQKWGRMVQPDHHAAPGGGGGGGGGARRMKGLAKKAMGKGCFGHKLDRIGSTSGLGC |
| Enzyme Length | 193 |
| Uniprot Accession Number | P0C7P5 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Bradykinin-potentiating peptide both inhibits the activity of the angiotensin-converting enzyme (ACE) and enhances the action of bradykinin by inhibiting the peptidases that inactivate it. It acts as an indirect hypotensive agent (By similarity). Neither synthetic Tf1, nor synthetic Tf2 show bradykinin-potentiating effects. {ECO:0000250, ECO:0000269|PubMed:17714693}.; FUNCTION: [C-type natriuretic peptide Tf-CNP]: Has a vasorelaxant activity in rat aortic strips and a diuretic potency in anesthetized rats. {ECO:0000269|PubMed:17714693}.; FUNCTION: [C-type natriuretic peptide Tf-CNP(6-22)]: Has a vasorelaxant activity in rat aortic strips and a diuretic potency in anesthetized rats. Is as potent as Tf-CNP. {ECO:0000269|PubMed:17714693}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Compositional bias (1); Disulfide bond (1); Modified residue (2); Peptide (6); Propeptide (4); Region (1); Signal peptide (1) |
| Keywords | Cleavage on pair of basic residues;Direct protein sequencing;Disulfide bond;Hypotensive agent;Metalloenzyme inhibitor;Metalloprotease inhibitor;Protease inhibitor;Pyrrolidone carboxylic acid;Secreted;Signal;Toxin;Vasoactive;Vasodilator |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | MOD_RES 28; /note=Pyrrolidone carboxylic acid; /evidence=ECO:0000250; MOD_RES 65; /note=Pyrrolidone carboxylic acid; /evidence=ECO:0000250 |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..23; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 20,051 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |