| IED ID | IndEnz0002018560 |
| Enzyme Type ID | protease018560 |
| Protein Name |
Protein AMBP Cleaved into: Alpha-1-microglobulin; Inter-alpha-trypsin inhibitor light chain ITI-LC Bikunin HI-30 Fragment |
| Gene Name | |
| Organism | Pleuronectes platessa (European plaice) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Actinopterygii Actinopteri Neopterygii Teleostei Osteoglossocephalai Clupeocephala Euteleosteomorpha Neoteleostei Eurypterygia Ctenosquamata Acanthomorphata Euacanthomorphacea Percomorphaceae Carangaria Pleuronectiformes (flatfishes) Pleuronectoidei Pleuronectidae (righteye flounders) Pleuronectes Pleuronectes platessa (European plaice) |
| Enzyme Sequence | RLKTTVVLVPLLLLGWTGTLQGLPVLPEPLYPTQENFDLTRFVGTWHDVALTSSCPHMQRNRADAAIGKLVLEKDTGNKLKVTRTRLRHGTCVEMSGEYELTSTPGRIFYHIDRWDADVDAYVVHTNYDEYAIIIMSKQKTSGENSTSLKLYSRTMSVRDTVLDDFKTLVRHQGMSDDTIIIKQNKGDCIPGEQVEEAPSQPEPKRLRRQVLPTLALSDEEGSGDMSALFNDSEACKAAPETGPCFGFIQGFFYNSTSMRCELFTYGGCLGNQNNFVTVRECLQRCRTEAVCRLPMAPEPCTGQPTIWAFDFVTGSCMPYKDGICQANANQFYSRAECQEYCGVIKDDGELLTAS |
| Enzyme Length | 355 |
| Uniprot Accession Number | P36992 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | BINDING 55; /note=3-hydroxy-L-kynurenine; binds multimeric 3-hydroxykynurenine chromophore; covalent; /evidence=ECO:0000250; BINDING 138; /note=3-hydroxy-L-kynurenine; binds multimeric 3-hydroxykynurenine chromophore; covalent; /evidence=ECO:0000250; BINDING 150; /note=3-hydroxy-L-kynurenine; binds multimeric 3-hydroxykynurenine chromophore; covalent; /evidence=ECO:0000250 |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Binding site (3); Chain (2); Disulfide bond (7); Domain (2); Glycosylation (3); Non-terminal residue (1); Signal peptide (1) |
| Keywords | Chromophore;Cleavage on pair of basic residues;Disulfide bond;Glycoprotein;Protease inhibitor;Repeat;Secreted;Serine protease inhibitor;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | PTM: The precursor is proteolytically processed into two separately functioning proteins. {ECO:0000250}.; PTM: 3-hydroxykynurenine, an oxidized tryptophan metabolite that is common in biological fluids, reacts with Cys-55, Lys-138, and Lys-150 to form heterogeneous polycyclic chromophores including hydroxanthommatin. The reaction by alpha-1-microglobulin is autocatalytic. The chromophore can react with accessible cysteines forming non-reducible thioether cross-links with other molecules of alpha-1-microglobulin or with other proteins (By similarity). {ECO:0000250}. |
| Signal Peptide | SIGNAL <1..?; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 39,669 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |