| IED ID | IndEnz0002018638 |
| Enzyme Type ID | protease018638 |
| Protein Name |
Cystatin-B PoCystatin-B Stefin-B |
| Gene Name | |
| Organism | Paralichthys olivaceus (Bastard halibut) (Hippoglossus olivaceus) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Actinopterygii Actinopteri Neopterygii Teleostei Osteoglossocephalai Clupeocephala Euteleosteomorpha Neoteleostei Eurypterygia Ctenosquamata Acanthomorphata Euacanthomorphacea Percomorphaceae Carangaria Pleuronectiformes (flatfishes) Pleuronectoidei Paralichthyidae (large-tooth flounders) Paralichthys Paralichthys olivaceus (Bastard halibut) (Hippoglossus olivaceus) |
| Enzyme Sequence | MLCGGTSQPVDADEQIQKICDSMKPHAEAQAGKTFDVFVAKTYTTQCVPGTNYFIKVHVGGDEHVHLRVYKKLPCNGETLELSKMLQDKRHHDPLEYF |
| Enzyme Length | 98 |
| Uniprot Accession Number | B2Z449 |
| Absorption | |
| Active Site | |
| Activity Regulation | ACTIVITY REGULATION: Greatly decreased inhibitory activity against papain protease by metal ions including ZnSO(4), CuSO(4), HgCl(2) and CoCl(2). Decreased inhibitory activity against papain protease by detergents including Tween 20, SDS and Brij 35. {ECO:0000269|PubMed:23648289}. |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Thiol protease inhibitor. Has high papain, bovine cathepsin B and fish cathepsins F and X inhibitory activity and inhibits fish cathepsins L, S and K to a lesser extent in vitro. May be involved in innate immunity. {ECO:0000269|PubMed:23648289}. |
| Temperature Dependency | BIOPHYSICOCHEMICAL PROPERTIES: Temperature dependence: Stable between 20 and 40 degrees Celsius. Activity for papain drops rapidly over 60 degrees Celsius. Retains inhibitory activity against papain for 10 days at 37 and 30 degrees Celsius. {ECO:0000269|PubMed:23648289}; |
| PH Dependency | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH is 6-7.5 and pH 6.5-8 for papain and bovine cathepsin B, respectively. {ECO:0000269|PubMed:23648289}; |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Domain (1); Motif (1); Site (1) |
| Keywords | Cytoplasm;Immunity;Innate immunity;Protease inhibitor;Thiol protease inhibitor |
| Interact With | |
| Induction | INDUCTION: By LPS. Slightly increased expression 24 hours post-injection in spleen and muscle. {ECO:0000269|PubMed:23648289}. |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250|UniProtKB:P04080}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | MOTIF 46..50; /note=Secondary area of contact; /evidence=ECO:0000250|UniProtKB:P04080 |
| Gene Encoded By | |
| Mass | 11,066 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |