| IED ID | IndEnz0002018639 |
| Enzyme Type ID | protease018639 |
| Protein Name |
Salivary cystatin-L2 Sialostatin-L2 |
| Gene Name | IscW_ISCW018602 |
| Organism | Ixodes scapularis (Black-legged tick) (Deer tick) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Chelicerata Arachnida Acari Parasitiformes Ixodida (ticks) Ixodoidea Ixodidae (hardbacked ticks) Ixodinae Ixodes Ixodes scapularis (Black-legged tick) (Deer tick) |
| Enzyme Sequence | MTSSLALVLVFGGAAVCAELALRGGYRERSNQDDPEYLELAHYATSTWSAQQPGKTHFDTVVEVLKVETQTVAGTNYRLTLKVAESTCELTSTYNKDTCQANANAAQRTCTTVIYRNLQGEKSISSFECAAA |
| Enzyme Length | 132 |
| Uniprot Accession Number | B7PKZ1 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Inhibitor of cysteine proteinases. Inhibits host immune responses, probably via its inhibition of host cathepsins. Contributes to the suppression of the host's immune response to tick salivary proteins and is important for successful feeding on hosts (PubMed:17698852). Down-regulates TLR2-mediated host responses to infection by B.burgdorferi and the production of chemokines CCL3 and CXCL10 by host dendritic cells (PubMed:25975355). Enhances infection by the tick-transmitted pathogen B.burgdorferi (in vitro) (PubMed:20545851). Inhibits host inflammatory responses to A.phagocytophilum infection (PubMed:24686067). Inhibits papain (in vitro) (PubMed:20545851). Inhibits cathepsin-L (CTSL) (in vitro) (PubMed:17698852, PubMed:20545851). Inhibits cathepsin-L2 (CTSV) (in vitro) (PubMed:17698852). {ECO:0000269|PubMed:17698852, ECO:0000269|PubMed:20545851, ECO:0000269|PubMed:24686067, ECO:0000305}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (4); Chain (1); Disulfide bond (2); Domain (1); Helix (1); Sequence conflict (2); Signal peptide (1); Site (1); Turn (1) |
| Keywords | 3D-structure;Disulfide bond;Protease inhibitor;Reference proteome;Secreted;Signal;Thiol protease inhibitor |
| Interact With | |
| Induction | INDUCTION: Strongly up-regulated in salivary gland during feeding. {ECO:0000269|PubMed:17698852}. |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..18; /evidence=ECO:0000255 |
| Structure 3D | X-ray crystallography (2) |
| Cross Reference PDB | 3LH4; 3MWZ; |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 14,323 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |