| IED ID | IndEnz0002018642 |
| Enzyme Type ID | protease018642 |
| Protein Name |
Derlin-1.1 ZmDerlin1-1 |
| Gene Name | DER1.1 SOR |
| Organism | Zea mays (Maize) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae Liliopsida Petrosaviidae commelinids Poales Poaceae PACMAD clade Panicoideae Andropogonodae Andropogoneae Tripsacinae Zea Zea mays (Maize) |
| Enzyme Sequence | MSSPAEYYKSLPPISKAYGTLCFFTTVLVQLQILHPLFLYLDYPLVFKKFEIWRLLTSFFFLAPFSMKFGIRLLMIARYGVMLEKGAFDKRTADFLWMMIFGAISLLVLSIIPLFNSFFLGIPMVSMLLYVWSRENPNAQINIYGLVQLRSFYLPWAMLLLDVIFGSSLMPGLLGIMVGHLYYFFAVLHPLATGKSYLKTPKWVHKIVARFRIGMQANSPVRPPANGNSGSGVFRGRSYRLNQ |
| Enzyme Length | 243 |
| Uniprot Accession Number | Q4G2J6 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: May be involved in the degradation process of specific misfolded endoplasmic reticulum (ER) luminal proteins. {ECO:0000269|PubMed:15849299}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Compositional bias (1); Erroneous gene model prediction (1); Region (1); Sequence caution (1); Sequence conflict (1); Topological domain (5); Transmembrane (4) |
| Keywords | Endoplasmic reticulum;Membrane;Reference proteome;Stress response;Transmembrane;Transmembrane helix |
| Interact With | |
| Induction | INDUCTION: By endoplasmic reticulum stress. {ECO:0000269|PubMed:15849299}. |
| Subcellular Location | SUBCELLULAR LOCATION: Endoplasmic reticulum membrane {ECO:0000269|PubMed:15849299}; Multi-pass membrane protein {ECO:0000269|PubMed:15849299}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 27,842 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |