| IED ID | IndEnz0002018645 |
| Enzyme Type ID | protease018645 |
| Protein Name |
Dickkopf-related protein 2 Dickkopf-2 Dkk-2 hDkk-2 |
| Gene Name | DKK2 UNQ682/PRO1316 |
| Organism | Homo sapiens (Human) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Homininae Homo Homo sapiens (Human) |
| Enzyme Sequence | MAALMRSKDSSCCLLLLAAVLMVESSQIGSSRAKLNSIKSSLGGETPGQAANRSAGMYQGLAFGGSKKGKNLGQAYPCSSDKECEVGRYCHSPHQGSSACMVCRRKKKRCHRDGMCCPSTRCNNGICIPVTESILTPHIPALDGTRHRDRNHGHYSNHDLGWQNLGRPHTKMSHIKGHEGDPCLRSSDCIEGFCCARHFWTKICKPVLHQGEVCTKQRKKGSHGLEIFQRCDCAKGLSCKVWKDATYSSKARLHVCQKI |
| Enzyme Length | 259 |
| Uniprot Accession Number | Q9UBU2 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (5); Glycosylation (1); Natural variant (1); Region (2); Signal peptide (1) |
| Keywords | Developmental protein;Disulfide bond;Glycoprotein;Reference proteome;Secreted;Signal;Wnt signaling pathway |
| Interact With | P60371 |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | PTM: May be proteolytically processed by a furin-like protease. |
| Signal Peptide | SIGNAL 1..33; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 11029007; 11137016; 11357136; 11433302; 11448771; 11742004; 12050670; 12167704; 12205098; 12527209; 12897152; 15084453; 15459103; 16568085; 17047023; 18044981; 18461655; 18502762; 18524778; 18606139; 19158955; 19247449; 19453261; 19562778; 19659606; 19755393; 20004015; 20053636; 20093360; 20332099; 20379614; 21312269; 21540552; 21944579; 21984209; 22000855; 22000856; 22653731; 22964660; 23204234; 23256519; 23791946; 23999978; 24117450; 25312721; 26715268; 27203079; 27296949; 27363011; 27431620; 28152305; 28467796; 29749862; 30320375; 30867812; 30990378; 31489578; 31583260; 31800554; 32945363; 33679613; 33909798; |
| Motif | |
| Gene Encoded By | |
| Mass | 28,447 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |