| IED ID | IndEnz0002018646 |
| Enzyme Type ID | protease018646 |
| Protein Name |
Transcriptional regulatory protein DegU Protease production enhancer protein |
| Gene Name | degU iep BSU35490 |
| Organism | Bacillus subtilis (strain 168) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus subtilis group Bacillus subtilis Bacillus subtilis subsp. subtilis Bacillus subtilis (strain 168) |
| Enzyme Sequence | MTKVNIVIIDDHQLFREGVKRILDFEPTFEVVAEGDDGDEAARIVEHYHPDVVIMDINMPNVNGVEATKQLVELYPESKVIILSIHDDENYVTHALKTGARGYLLKEMDADTLIEAVKVVAEGGSYLHPKVTHNLVNEFRRLATSGVSAHPQHEVYPEIRRPLHILTRRECEVLQMLADGKSNRGIGESLFISEKTVKNHVSNILQKMNVNDRTQAVVVAIKNGWVEMR |
| Enzyme Length | 229 |
| Uniprot Accession Number | P13800 |
| Absorption | |
| Active Site | |
| Activity Regulation | ACTIVITY REGULATION: Phosphorylated and unphosphorylated forms are both active and have different functions. A low concentration of phospho-DegU is sufficient to activate transcription of flagellar genes, but a higher concentration of phospho-DegU is required for transcription of other genes. Phosphorylated DegU is stabilized by DegR. {ECO:0000269|PubMed:1321152, ECO:0000269|PubMed:1459944, ECO:0000269|PubMed:17850253}. |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | DNA_BIND 183..202; /note=H-T-H motif; /evidence=ECO:0000255|PROSITE-ProRule:PRU00411 |
| EC Number | |
| Enzyme Function | FUNCTION: Member of the two-component regulatory system DegS/DegU, which plays an important role in the transition growth phase. Involved in the control of expression of different cellular functions, including production of degradative enzymes such as the neutral and alkaline proteases, flagellum formation, biofilm formation, and competence for DNA uptake. Positively or negatively regulates expression of many different genes. The phosphorylated form is required for synthesis of degradative enzymes, flagellum formation and biofilm formation. The unphosphorylated form is required for expression of genetic competence, via induction of comK. {ECO:0000269|PubMed:12471443, ECO:0000269|PubMed:1321152, ECO:0000269|PubMed:17850253, ECO:0000269|PubMed:1901568, ECO:0000269|PubMed:2123196, ECO:0000269|PubMed:8955341}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); DNA binding (1); Domain (2); Modified residue (1); Mutagenesis (6) |
| Keywords | Activator;Cytoplasm;DNA-binding;Phosphoprotein;Reference proteome;Repressor;Transcription;Transcription regulation;Two-component regulatory system |
| Interact With | |
| Induction | INDUCTION: Phosphorylated DegU activates its own expression. {ECO:0000269|PubMed:17850253}. |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000305}. |
| Modified Residue | MOD_RES 56; /note=4-aspartylphosphate; /evidence=ECO:0000305 |
| Post Translational Modification | PTM: Phosphorylated and dephosphorylated by DegS. {ECO:0000269|PubMed:1901568, ECO:0000269|PubMed:2123196}. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 25,867 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |