| IED ID | IndEnz0002018763 |
| Enzyme Type ID | protease018763 |
| Protein Name |
Major pepsin inhibitor 3 PI-3 |
| Gene Name | |
| Organism | Ascaris suum (Pig roundworm) (Ascaris lumbricoides) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Nematoda (roundworms) Chromadorea Rhabditida Spirurina Ascaridomorpha Ascaridoidea Ascarididae Ascaris Ascaris suum (Pig roundworm) (Ascaris lumbricoides) |
| Enzyme Sequence | MHVWLILSLASLWTSSIAYSQFLFSMSTGPFICTVKDNQVFVANLPWTMLEGDDIQVGKEFAARVEDCTNVKHDMAPTCTKPPPFCGPQDMKMFNFVGCSVLGNKLFIDQKYVRDLTAKDHAEVQTFREKIAAFEEQQENQPPSSGMPHGAVPAGGLSPPPPPSFCTVQ |
| Enzyme Length | 169 |
| Uniprot Accession Number | P19400 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: This is an inhibitor of the aspartic protease pepsin. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (8); Chain (1); Compositional bias (1); Disulfide bond (3); Helix (6); Modified residue (1); Region (1); Signal peptide (1) |
| Keywords | 3D-structure;Aspartic protease inhibitor;Direct protein sequencing;Disulfide bond;Protease inhibitor;Pyrrolidone carboxylic acid;Secreted;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | MOD_RES 21; /note=Pyrrolidone carboxylic acid; /evidence=ECO:0000269|PubMed:2223768 |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..20; /evidence=ECO:0000269|PubMed:2223768 |
| Structure 3D | X-ray crystallography (2) |
| Cross Reference PDB | 1F32; 1F34; |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 18,657 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |