| IED ID | IndEnz0002018802 | 
| Enzyme Type ID | protease018802 | 
| Protein Name | 
                        
                            
                                Serine protease inhibitor 1  ASPI-1  | 
                    
| Gene Name | |
| Organism | Anisakis simplex (Herring worm) | 
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Nematoda (roundworms) Chromadorea Rhabditida Spirurina Ascaridomorpha Ascaridoidea Anisakidae Anisakis Anisakis simplex complex Anisakis simplex (Herring worm) | 
| Enzyme Sequence | MMFTPLIVLTLLVLATAEHQCGPNEQWSDCPGCELQCGESDKPCPAMCGDPKCYCSPDQYRRIPDGRCIRKIQCPQH | 
| Enzyme Length | 77 | 
| Uniprot Accession Number | O77416 | 
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Defends the organism against the host's proteinases. {ECO:0000250}. | 
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (5); Domain (1); Signal peptide (1); Site (1) | 
| Keywords | Disulfide bond;Protease inhibitor;Secreted;Serine protease inhibitor;Signal | 
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250}. | 
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..17; /evidence=ECO:0000255 | 
| Structure 3D | |
| Cross Reference PDB | - | 
| Mapped Pubmed ID | - | 
| Motif | |
| Gene Encoded By | |
| Mass | 8,628 | 
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |