| IED ID | IndEnz0002018839 |
| Enzyme Type ID | protease018839 |
| Protein Name |
Procathepsin L EC 3.4.22.15 Cathepsin L1 Cleaved into: Cathepsin L heavy chain; Cathepsin L light chain; Cathepsin L Fragments |
| Gene Name | CTSL CTSL1 |
| Organism | Gallus gallus (Chicken) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Sauropsida Sauria (diapsids) Archelosauria Archosauria Dinosauria Saurischia Theropoda Coelurosauria Aves Neognathae Galloanserae Galliformes Phasianidae (turkeys) Phasianinae Gallus Gallus gallus (Chicken) |
| Enzyme Sequence | APRSVDWREKGYVTPVKDQGQCGSCWAFSTTGALEGQHFRTKGKLVSLSEQNLVDCSRPEGNQGCNGGLMDQAFQYVQDNGGIDSEESYPYTAKDDEDCRYKAEYNAANDTGFVDIPQGHERALMKAVASVGPVSVAIDAGHSSFQFYQSGIYYEPDCSSEDLDHGVLVVGYGFEGGKKYWIVKNSWGEKWGDKGYIYMAKDRKNHCGIATAASYPLV |
| Enzyme Length | 218 |
| Uniprot Accession Number | P09648 |
| Absorption | |
| Active Site | ACT_SITE 25; /evidence=ECO:0000250; ACT_SITE 165; /evidence=ECO:0000250; ACT_SITE 185; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Specificity close to that of papain. As compared to cathepsin B, cathepsin L exhibits higher activity toward protein substrates, but has little activity on Z-Arg-Arg-NHMec, and no peptidyl-dipeptidase activity.; EC=3.4.22.15; |
| DNA Binding | |
| EC Number | 3.4.22.15 |
| Enzyme Function | FUNCTION: Important for the overall degradation of proteins in lysosomes. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Chain (3); Disulfide bond (3); Non-adjacent residues (1); Sequence conflict (7) |
| Keywords | Cell membrane;Cytoplasmic vesicle;Direct protein sequencing;Disulfide bond;Hydrolase;Lysosome;Membrane;Protease;Reference proteome;Secreted;Thiol protease |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Lysosome {ECO:0000250|UniProtKB:P06797}. Apical cell membrane {ECO:0000250|UniProtKB:P06797}; Peripheral membrane protein {ECO:0000250|UniProtKB:P06797}; Extracellular side {ECO:0000250|UniProtKB:P06797}. Cytoplasmic vesicle, secretory vesicle, chromaffin granule {ECO:0000250|UniProtKB:P25975}. Secreted, extracellular space {ECO:0000250|UniProtKB:P06797}. Secreted {ECO:0000250|UniProtKB:P06797}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 23,963 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |