| IED ID | IndEnz0002018865 |
| Enzyme Type ID | protease018865 |
| Protein Name |
Brachyurin EC 3.4.21.32 Collagenolytic protease |
| Gene Name | |
| Organism | Leptuca pugilator (Atlantic sand fiddler crab) (Uca pugilator) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Mandibulata Pancrustacea Crustacea Multicrustacea Malacostraca Eumalacostraca Eucarida Decapoda Pleocyemata Brachyura (short-tailed crabs) Eubrachyura Thoracotremata Ocypodoidea Ocypodidae Gelasiminae Leptuca Leptuca pugilator (Atlantic sand fiddler crab) (Uca pugilator) |
| Enzyme Sequence | IVGGVEAVPNSWPHQAALFIDDMYFCGGSLISPEWILTAAHCMDGAGFVDVVLGAHNIREDEATQVTIQSTDFTVHENYNSFVISNDIAVIRLPVPVTLTAAIATVGLPSTDVGVGTVVTPTGWGLPSDSALGISDVLRQVDVPIMSNADCDAVYGIVTDGNICIDSTGGKGTCNGDSGGPLNYNGLTYGITSFGAAAGCEAGYPDAFTRVTYFLDWIQTQTGITP |
| Enzyme Length | 226 |
| Uniprot Accession Number | P00771 |
| Absorption | |
| Active Site | ACT_SITE 41; /note=Charge relay system; ACT_SITE 87; /note=Charge relay system; ACT_SITE 178; /note=Charge relay system |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Hydrolysis of proteins, with broad specificity for peptide bonds. Native collagen is cleaved about 75% of the length of the molecule from the N-terminus. Low activity on small molecule substrates of both trypsin and chymotrypsin.; EC=3.4.21.32; |
| DNA Binding | |
| EC Number | 3.4.21.32 |
| Enzyme Function | FUNCTION: This enzyme is a serine protease capable of degrading the native triple helix of collagen. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Beta strand (16); Chain (1); Disulfide bond (3); Domain (1); Helix (4); Sequence conflict (4); Turn (3) |
| Keywords | 3D-structure;Collagen degradation;Direct protein sequencing;Disulfide bond;Hydrolase;Protease;Serine protease |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 1AZZ; |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 23,511 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |