| IED ID | IndEnz0002018886 | 
| Enzyme Type ID | protease018886 | 
| Protein Name | 
                        
                            
                                Defensin-like protein 21  Small protein inhibitor of insect alpha-amylases 2.1 SI alpha-2.1  | 
                    
| Gene Name | |
| Organism | Sorghum bicolor (Sorghum) (Sorghum vulgare) | 
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae Liliopsida Petrosaviidae commelinids Poales Poaceae PACMAD clade Panicoideae Andropogonodae Andropogoneae Sorghinae Sorghum Sorghum bicolor (Sorghum) (Sorghum vulgare) | 
| Enzyme Sequence | RVCRRRSAGFKGLCMSDHNCAQVCLQEGWGGGNCDGVMRQCKCIRQC | 
| Enzyme Length | 47 | 
| Uniprot Accession Number | Q09198 | 
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (4) | 
| Keywords | Antimicrobial;Direct protein sequencing;Disulfide bond;Fungicide;Plant defense | 
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - | 
| Mapped Pubmed ID | - | 
| Motif | |
| Gene Encoded By | |
| Mass | 5,222 | 
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |