| IED ID | IndEnz0002018995 |
| Enzyme Type ID | protease018995 |
| Protein Name |
Cathepsin B-like cysteine proteinase 3 EC 3.4.22.- Fragment |
| Gene Name | CP-3 |
| Organism | Ostertagia ostertagi (Brown stomach worm) (Strongylus ostertagi) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Nematoda (roundworms) Chromadorea Strongylida Trichostrongyloidea Haemonchidae Ostertagia Ostertagia ostertagi (Brown stomach worm) (Strongylus ostertagi) |
| Enzyme Sequence | AWQYFALEGVVTGGNYRKQGCCRPYEFPPCGRHGKEPYYGECYDTAKTPKCQKTCQRGYLKAYKEDKHFGKSAYRLPNNVKAIQRDIMKNGPVVAGFIVYEDFAHYKSGIYKHTAGRMTGGHAVKIIGWGKEKGTPYWLIANSWHDDWGEKGFYRMIRGINNCRIEEMVFAGIV |
| Enzyme Length | 174 |
| Uniprot Accession Number | Q06544 |
| Absorption | |
| Active Site | ACT_SITE 122; /evidence=ECO:0000250; ACT_SITE 142; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.22.- |
| Enzyme Function | FUNCTION: Expression of the protease correlates with blood-feeding and suggests a role for the protease in blood digestion. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Chain (1); Disulfide bond (2); Non-terminal residue (1) |
| Keywords | Disulfide bond;Hydrolase;Protease;Thiol protease;Zymogen |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 19,939 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |