| IED ID | IndEnz0002018996 |
| Enzyme Type ID | protease018996 |
| Protein Name |
Cysteine proteinase inhibitor 3 AtCYS-3 |
| Gene Name | CYS3 FL3-27 At2g40880 T20B5.8 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MESKTFWIVTLLLCGTIQLAICRSEEKSTEKTMMLGGVHDLRGNQNSGEIESLARFAIQEHNKQQNKILEFKKIVKAREQVVAGTMYHLTLEAKEGDQTKNFEAKVWVKPWMNFKQLQEFKESSS |
| Enzyme Length | 125 |
| Uniprot Accession Number | Q41906 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Specific inhibitor of cysteine proteinases. Probably involved in the regulation of endogenous processes and in defense against pests and pathogens (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Domain (1); Erroneous initiation (1); Frameshift (1); Motif (1); Signal peptide (1); Site (1) |
| Keywords | Plant defense;Protease inhibitor;Reference proteome;Secreted;Signal;Thiol protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..22; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 12102506; 12609038; 12787025; 15235117; 15347791; 16911220; 18523728; 18775970; 18796151; 21798944; 27247031; 27816823; |
| Motif | MOTIF 80..84; /note=Secondary area of contact; /evidence=ECO:0000250 |
| Gene Encoded By | |
| Mass | 14,422 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |