| IED ID | IndEnz0002019003 | 
| Enzyme Type ID | protease019003 | 
| Protein Name | 
                        
                            
                                Desumoylating isopeptidase 1  DeSI-1 EC 3.4.-.- PPPDE peptidase domain-containing protein 2  | 
                    
| Gene Name | desi1 fam152b pppde2 | 
| Organism | Xenopus laevis (African clawed frog) | 
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amphibia Batrachia Anura Pipoidea Pipidae Xenopodinae Xenopus Xenopus Xenopus laevis (African clawed frog) | 
| Enzyme Sequence | METAEGPHLVRLYVYDMSRGLARRLSPVMLGKQLEGIWHTSIIVFDEEFFYGREGITSCLPGRTMLGEPDSVMELGITEVTEEIFLEYLSSLGESGFSGESYHLFDHNCNTFSNEVAQFLTGKKIPSYITELPSEVLSTPLGQALRPLLDSVQIQPAGGNIFNRQSGPS | 
| Enzyme Length | 169 | 
| Uniprot Accession Number | Q6GLM5 | 
| Absorption | |
| Active Site | ACT_SITE 39; /evidence=ECO:0000255|PROSITE-ProRule:PRU01205; ACT_SITE 109; /evidence=ECO:0000255|PROSITE-ProRule:PRU01205 | 
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.-.- | 
| Enzyme Function | FUNCTION: Protease which deconjugates SUMO1, SUMO2 and SUMO3 from some substrate proteins (By similarity). Has isopeptidase but not SUMO-processing activity (By similarity). Collaborates with ubqln4 in the export of ubiquitinated proteins from the nucleus to the cytoplasm (By similarity). {ECO:0000250|UniProtKB:Q6ICB0, ECO:0000250|UniProtKB:Q9CQT7}. | 
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Chain (1); Domain (1); Motif (2) | 
| Keywords | Cytoplasm;Hydrolase;Nucleus;Protease | 
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250|UniProtKB:Q9CQT7}. Nucleus {ECO:0000250|UniProtKB:Q9CQT7}. | 
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - | 
| Mapped Pubmed ID | - | 
| Motif | MOTIF 84..92; /note=Nuclear export signal 1; /evidence=ECO:0000250|UniProtKB:Q6ICB0; MOTIF 140..154; /note=Nuclear export signal 2; /evidence=ECO:0000250|UniProtKB:Q6ICB0 | 
| Gene Encoded By | |
| Mass | 18,737 | 
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |