| IED ID | IndEnz0002019016 |
| Enzyme Type ID | protease019016 |
| Protein Name |
Deoxyuridine 5'-triphosphate nucleotidohydrolase dUTPase EC 3.6.1.23 dUTP pyrophosphatase |
| Gene Name | DUT F16 |
| Organism | Vaccinia virus (strain L-IVP) (VACV) |
| Taxonomic Lineage | Viruses Varidnaviria Bamfordvirae Nucleocytoviricota Pokkesviricetes Chitovirales Poxviridae Chordopoxvirinae Orthopoxvirus Vaccinia virus Vaccinia virus (strain L-IVP) (VACV) |
| Enzyme Sequence | MFNMNINSPVRFVKETNRAKSPTRQSPGAAGYDLYSAYDYTIPPGERQLIKTDISMSMPKICYGRIAPRSGLSLKGIDIGGGVIDEDYRGNIGVILINNGKCTFNVNTGDRIAQLIYQRIYYPELEEVQSLDSTNRGDQGFGSTGLR |
| Enzyme Length | 147 |
| Uniprot Accession Number | P68635 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=dUTP + H2O = diphosphate + dUMP + H(+); Xref=Rhea:RHEA:10248, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:33019, ChEBI:CHEBI:61555, ChEBI:CHEBI:246422; EC=3.6.1.23; |
| DNA Binding | |
| EC Number | 3.6.1.23 |
| Enzyme Function | FUNCTION: This enzyme is involved in nucleotide metabolism: it produces dUMP, the immediate precursor of thymidine nucleotides and it decreases the intracellular concentration of dUTP so that uracil cannot be incorporated into DNA. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1) |
| Keywords | Hydrolase;Magnesium;Metal-binding;Nucleotide metabolism |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 16,264 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:10248 |
| Cross Reference Brenda |