| IED ID | IndEnz0002019040 |
| Enzyme Type ID | protease019040 |
| Protein Name |
Disulfide bond formation protein D Disulfide oxidoreductase D Thiol-disulfide oxidoreductase D |
| Gene Name | bdbD yvgV BSU33480 |
| Organism | Bacillus subtilis (strain 168) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus subtilis group Bacillus subtilis Bacillus subtilis subsp. subtilis Bacillus subtilis (strain 168) |
| Enzyme Sequence | MKKKQQSSAKFAVILTVVVVVLLAAIVIINNKTEQGNDAVSGQPSIKGQPVLGKDDAPVTVVEFGDYKCPSCKVFNSDIFPKIQKDFIDKGDVKFSFVNVMFHGKGSRLAALASEEVWKEDPDSFWDFHEKLFEKQPDTEQEWVTPGLLGDLAKSTTKIKPETLKENLDKETFASQVEKDSDLNQKMNIQATPTIYVNDKVIKNFADYDEIKETIEKELKGK |
| Enzyme Length | 222 |
| Uniprot Accession Number | O32218 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Required for the stabilization, possibly via formation of a disulfide bond, of the obligatory competence protein ComGC. May be required for the stability of secreted proteins with disulfide bonds. Not required for sporulation. {ECO:0000269|PubMed:11744713}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (6); Chain (1); Disulfide bond (1); Domain (1); Helix (9); Mutagenesis (1); Signal peptide (1); Turn (2) |
| Keywords | 3D-structure;Cell membrane;Competence;Disulfide bond;Membrane;Oxidoreductase;Redox-active center;Reference proteome;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:20713508, ECO:0000269|PubMed:22882210}. Membrane raft {ECO:0000269|PubMed:20713508, ECO:0000269|PubMed:22882210}. Note=Present in detergent-resistant membrane (DRM) fractions that may be equivalent to eukaryotic membrane rafts; these rafts include proteins involved in signaling, molecule trafficking and protein secretion. {ECO:0000269|PubMed:20713508, ECO:0000269|PubMed:22882210}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..36; /evidence=ECO:0000255 |
| Structure 3D | X-ray crystallography (4) |
| Cross Reference PDB | 3EU3; 3EU4; 3GH9; 3GHA; |
| Mapped Pubmed ID | 19535335; |
| Motif | |
| Gene Encoded By | |
| Mass | 24,905 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |