| IED ID | IndEnz0002019052 |
| Enzyme Type ID | protease019052 |
| Protein Name |
Alkaline proteinase ALP EC 3.4.21.- Fragments |
| Gene Name | |
| Organism | Fusarium culmorum |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Pezizomycotina leotiomyceta sordariomyceta Sordariomycetes Hypocreomycetidae Hypocreales Nectriaceae Fusarium Fusarium sambucinum species complex Fusarium culmorum |
| Enzyme Sequence | GSTSYIYDTSAGSGTYAYIVDTGIITSHNGFNWAANDIISKSYSNYGTVLDIFAPGTSVLSS |
| Enzyme Length | 62 |
| Uniprot Accession Number | P83610 |
| Absorption | |
| Active Site | ACT_SITE 21; /note=Charge relay system; /evidence=ECO:0000255|PROSITE-ProRule:PRU10080 |
| Activity Regulation | ACTIVITY REGULATION: Inhibited by phenylmethanesulfonyl fluoride (PMSF) and chymostatin (CST), but not by Bowman-Birk type trypsin-chymotrypsin inhibitor (BBI). {ECO:0000269|PubMed:11846781}. |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.21.- |
| Enzyme Function | FUNCTION: Serine protease. May be involved in the invasion of grains and hydrolyzation of grain proteins. {ECO:0000269|PubMed:11846781}. |
| Temperature Dependency | BIOPHYSICOCHEMICAL PROPERTIES: Temperature dependence: Optimum temperature is 40 degrees Celsius.; |
| PH Dependency | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH is 8.3-9.6.; |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Domain (1); Non-adjacent residues (2); Non-terminal residue (2) |
| Keywords | Direct protein sequencing;Hydrolase;Protease;Secreted;Serine protease |
| Interact With | |
| Induction | INDUCTION: By gluten. {ECO:0000269|PubMed:11846781}. |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 6,493 |
| Kinetics | BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=3.1 mM for N-succinyl-Ala-Ala-Pro-Phe p-nitroanilide (at pH 6.0 with dimethylsulfoxide); KM=2.3 mM for N-succinyl-Ala-Ala-Pro-Phe p-nitroanilide (at pH 9.0 with dimethylsulfoxide); KM=1.1 mM for N-succinyl-Ala-Ala-Pro-Phe p-nitroanilide (at pH 9.0 without dimethylsulfoxide); |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |